Z4YLT8_MOUSE Loading...

RING finger protein 11

Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.

AlphaFold DB , UniProt , Accession Z4YLT8, Species MOUSE (Mus musculus, Mouse), Gene Rnf11, Length 144 aa.

						>Z4YLT8_MOUSE|Z4YLT8|Rnf11
MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.8	Very low	43.8	Very low	249 Å²	249	136.5 Å²	136.5	100%	1.227	81%	0.809	S	S	*	*				0	131.6	0	-75.9	80.5	164.3	0	0	108.9
2	G	42.5	Very low	43.1	Very low	81 Å²	81	134.4 Å²	134.4	84%	0.835	79%	0.791	S	S	*	*			trans	139.4	69.7	169	0	0	0	0	0	114.8
3	N	42.9	Very low	43	Very low	158 Å²	158	137.5 Å²	137.5	85%	0.845	80%	0.799	S	S	*	*			trans	-78.1	153.7	163.1	-106.6	33.8	0	0	0	110.6
4	C	50.8	Low	42.9	Very low	115 Å²	115	134 Å²	134	78%	0.777	79%	0.786	S	S	*	*			trans	160.5	143.3	132.7	-81.1	0	0	0	0	109.3
5	L	48.1	Very low	42.9	Very low	126 Å²	126	135.4 Å²	135.4	66%	0.66	79%	0.788	S	S	*	*			cis	-173.3	130.1	-9.2	-96.4	177.5	0	0	0	106.5
6	K	41.1	Very low	42.6	Very low	167 Å²	167	138.2 Å²	138.2	73%	0.726	80%	0.797	S	S	*	*			trans	40.1	124.1	146.2	40.6	167.1	174.7	-104.4	0	125.2
7	S	44.3	Very low	42.7	Very low	111 Å²	111	140.1 Å²	140.1	78%	0.776	80%	0.797	S	S	*	*			trans	44.4	148.3	133	-26	0	0	0	0	124
8	P	48.1	Very low	42.6	Very low	119 Å²	119	141.3 Å²	141.3	77%	0.773	80%	0.795	S	S	*	*				-137.8	136.9	76.5	28.9	-8.9	0	0	0	114.9
9	T	45.5	Very low	42.3	Very low	116 Å²	116	140.6 Å²	140.6	71%	0.712	80%	0.8	S	S	*	*				54.2	115.5	91	66.8	0	0	0	0	118.6
10	S	38.7	Very low	42.1	Very low	108 Å²	108	142.2 Å²	142.2	76%	0.755	80%	0.8	S	S	*	*			trans	169	86.9	133.7	-66.8	0	0	0	0	106.1
11	D	40.4	Very low	41.8	Very low	152 Å²	152	140 Å²	140	81%	0.813	80%	0.795	S	S	*	*				61.8	139.9	95.5	-58.5	-44.8	0	0	0	112.3
12	D	35.4	Very low	41.5	Very low	111 Å²	111	136.5 Å²	136.5	59%	0.594	78%	0.781	S	S	*	*			cis	-177.5	116.9	-12.9	177.7	-80.6	0	0	0	100.9	S14	D12-S14 WeakPolarHBondContact OD1-CB 3.49Å; D12-S14 PolarHBondContact OD1-N 3.08Å; D12-S14 VanDerWaalsContact OD1-N 3.08Å; D12-S14 PolarHBondContact OD1-OG 3.32Å
13	I	41.5	Very low	41.3	Very low	175 Å²	175	144 Å²	144	90%	0.897	78%	0.784	S	S	*	*			trans	-114.1	72.7	171.1	-62.2	-69.4	0	0	0	106.9
14	S	42.1	Very low	40.8	Very low	88 Å²	88	140.8 Å²	140.8	62%	0.615	78%	0.779	S	S	*	*			trans	-85.3	105.4	162.6	-60	0	0	0	0	109.7	D12	D12-S14 WeakPolarHBondContact OD1-CB 3.49Å; D12-S14 PolarHBondContact OD1-N 3.08Å; D12-S14 VanDerWaalsContact OD1-N 3.08Å; D12-S14 PolarHBondContact OD1-OG 3.32Å
15	L	42	Very low	40.2	Very low	155 Å²	155	141.1 Å²	141.1	81%	0.812	78%	0.783	S	S	*	*			trans	-4.6	124.9	141.1	-61.7	166	0	0	0	115
16	L	39.1	Very low	39.6	Very low	180 Å²	180	145.1 Å²	145.1	94%	0.942	80%	0.795	S	S	*	*			trans	-150.9	116.8	136.5	-73	-173	0	0	0	111.2
17	H	43.2	Very low	39.4	Very low	171 Å²	171	140.8 Å²	140.8	79%	0.792	80%	0.798	S	S	*	*			trans	-67.8	160	155.9	174.8	-110.6	0	0	0	109.8
18	E	41.1	Very low	39.3	Very low	161 Å²	161	145.6 Å²	145.6	75%	0.752	81%	0.808	S	S	*	*			trans	91.2	107.5	176.7	-65.6	-173	65	0	0	117.9
19	S	36.7	Very low	38.7	Very low	129 Å²	129	143 Å²	143	90%	0.902	80%	0.804	S	S	*	*			trans	-135.2	98.2	141.8	36.9	0	0	0	0	108.4
20	Q	37.9	Very low	38.5	Very low	171 Å²	171	144.3 Å²	144.3	80%	0.799	81%	0.811	S	S	*	*			trans	-95.1	135.4	158.1	-129.1	176.5	83.9	0	0	107.6
21	S	35.9	Very low	38.4	Very low	98 Å²	98	147 Å²	147	69%	0.685	81%	0.812	S	S	*	*			trans	76	109.4	163.4	-50.5	0	0	0	0	117.4
22	D	34.3	Very low	38.7	Very low	175 Å²	175	145 Å²	145	94%	0.936	81%	0.808	S	S	*	*				-164.2	150.6	108.3	-99	-48.6	0	0	0	112.7
23	R	38.5	Very low	39.3	Very low	238 Å²	238	147.7 Å²	147.7	90%	0.898	82%	0.822	S	S	*	*			trans	-106.1	143.6	-160.1	-171.4	168.4	90.2	-171.8	8.2	111.8
24	A	32.8	Very low	39.6	Very low	91 Å²	91	147.4 Å²	147.4	75%	0.752	82%	0.817	S	S	*	*			trans	78	125.4	156.9	0	0	0	0	0	120
25	S	36.3	Very low	39.9	Very low	121 Å²	121	151.6 Å²	151.6	85%	0.846	83%	0.827	S	S	*	*				-173.3	146.8	101.9	-157.7	0	0	0	0	111.8
26	F	37.4	Very low	40.4	Very low	210 Å²	210	149.5 Å²	149.5	92%	0.921	82%	0.822	S	S	*	*			trans	-72.6	148	-176.9	-72.5	-101.7	0	0	0	112.8
27	G	35.4	Very low	41.1	Very low	77 Å²	77	146.4 Å²	146.4	79%	0.794	81%	0.813	S	S	*	*			trans	-161.8	100.7	169.4	0	0	0	0	0	110.7
28	E	42.1	Very low	41.8	Very low	211 Å²	211	143.6 Å²	143.6	99%	0.986	81%	0.81	S	S	*	*			trans	-70.3	132.6	178.6	-155.7	161.8	87.6	0	0	110.4
29	G	36.3	Very low	42.8	Very low	65 Å²	65	141.2 Å²	141.2	67%	0.67	81%	0.809	S	S	*	*			trans	-166.3	97.5	-179.5	0	0	0	0	0	111.6
30	T	40.3	Very low	43.9	Very low	143 Å²	143	143.9 Å²	143.9	88%	0.877	80%	0.8	S	S	*	*			trans	-0.4	112.8	160.6	-9.4	0	0	0	0	117	P32	T30-P32 WeakPolarHBondContact O-CD 3.45Å
31	E	37.1	Very low	45.2	Very low	164 Å²	164	144.1 Å²	144.1	77%	0.766	80%	0.801	S	S	*	*			trans	-70.1	127.6	165.6	-77.4	-141.1	95.3	0	0	111
32	P	46.4	Very low	46.6	Very low	112 Å²	112	146.6 Å²	146.6	73%	0.727	80%	0.802	S	S	*	*			trans	-87.6	128.4	157.9	30.4	-20.8	0	0	0	109.5	T30 Q34	T30-P32 WeakPolarHBondContact O-CD 3.45Å; P32-Q34 PolarHBondContact O-N 3.1Å; P32-Q34 VanDerWaalsContact O-N 3.08Å
33	D	49.3	Very low	48	Very low	167 Å²	167	146.3 Å²	146.3	89%	0.893	80%	0.795	S	S	*	*			trans	-17.4	101.8	170.6	-100.6	-96.2	0	0	0	114.1	E35	D33-E35 PolarHBondContact O-N 2.91Å
34	Q	46.4	Very low	49.4	Very low	169 Å²	169	140.4 Å²	140.4	79%	0.79	79%	0.785	S	S	*	*			trans	-82.3	102.5	170.5	-151.3	161.1	48.1	0	0	107.1	P32	P32-Q34 PolarHBondContact O-N 3.1Å; P32-Q34 VanDerWaalsContact O-N 3.08Å
35	E	48.2	Very low	51.5	Low	175 Å²	175	141.7 Å²	141.7	82%	0.818	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-51.7	135.8	170.5	-76.2	-159.3	116	0	0	109.4	D33	D33-E35 PolarHBondContact O-N 2.91Å
36	P	52.9	Low	53.5	Low	111 Å²	111	139.2 Å²	139.2	72%	0.721	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-59.4	143.4	-178.7	24.2	-32.5	0	0	0	110
37	P	53.9	Low	55.5	Low	116 Å²	116	132.3 Å²	132.3	75%	0.753	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-56.2	144.3	177.2	24.2	-33.1	0	0	0	109.8
38	P	58.2	Low	57.8	Low	112 Å²	112	133.6 Å²	133.6	73%	0.727	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-54.7	147.5	178.9	23.5	-33	0	0	0	109.9	Y40	P38-Y40 PolarHBondContact O-N 2.79Å; P38-Y40 VanDerWaalsContact O-N 3.1Å
39	P	61.3	Low	59.6	Low	111 Å²	111	126.2 Å²	126.2	72%	0.721	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-56.9	125.1	177.8	24.9	-32	0	0	0	107.8	Q41	P39-Q41 PolarHBondContact O-N 3Å
40	Y	61.3	Low	61.8	Low	185 Å²	185	126.1 Å²	126.1	73%	0.725	68%	0.675	S	S	*	*			trans	-42.2	107.8	176.7	56.5	-81.8	0	0	0	109.4	P38 E42	P38-Y40 PolarHBondContact O-N 2.79Å; P38-Y40 VanDerWaalsContact O-N 3.1Å; Y40-E42 HydrophobicContact CD2-CB 4.13Å; Y40-E42 WeakPolarHBondContact CD2-OE2 3.48Å; Y40-E42 WeakPolarHBondContact CE2-OE2 3.26Å; Y40-E42 PolarHBondContact O-N 2.88Å
41	Q	63.8	Low	63	Low	175 Å²	175	121.1 Å²	121.1	82%	0.818	65%	0.645	S	S	*	*			trans	-75.5	92	162.9	-83.1	-177.9	-58.1	0	0	105.4	P39 Q43	P39-Q41 PolarHBondContact O-N 3Å; Q41-Q43 PolarHBondContact O-N 3.32Å
42	E	65.2	Low	64.6	Low	150 Å²	150	116.3 Å²	116.3	70%	0.701	63%	0.627	S	S	*	*			trans	-62.9	90	172.9	-146.3	164.2	109.7	0	0	107.6	Y40 V44	Y40-E42 HydrophobicContact CD2-CB 4.13Å; Y40-E42 WeakPolarHBondContact CD2-OE2 3.48Å; Y40-E42 WeakPolarHBondContact CE2-OE2 3.26Å; Y40-E42 PolarHBondContact O-N 2.88Å; E42-V44 PolarHBondContact O-N 3.07Å
43	Q	64.8	Low	65.9	Low	170 Å²	170	116.7 Å²	116.7	79%	0.794	63%	0.629	S	S	*	*			trans	-70.9	88.8	172.9	-70.6	-178.7	-9.1	0	0	106.7	Q41 P45	Q41-Q43 PolarHBondContact O-N 3.32Å; Q43-P45 VanDerWaalsContact O-CD 3.26Å; Q43-P45 WeakPolarHBondContact O-CD 3.44Å; Q43-P45 VanDerWaalsContact O-N 3.15Å
44	V	67.8	Low	67.2	Low	114 Å²	114	114.4 Å²	114.4	69%	0.691	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-58.4	119.1	174.2	-164.6	0	0	0	0	107.2	E42 V46	E42-V44 PolarHBondContact O-N 3.07Å; V44-V46 PolarHBondContact O-N 2.9Å; V44-V46 VanDerWaalsContact O-N 3.07Å
45	P	77.1	Confident	68.8	Low	117 Å²	117	110.1 Å²	110.1	76%	0.76	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-61	117.3	-178.8	-21.5	31.9	0	0	0	109.6	Q43 P47	Q43-P45 VanDerWaalsContact O-CD 3.26Å; Q43-P45 WeakPolarHBondContact O-CD 3.44Å; Q43-P45 VanDerWaalsContact O-N 3.15Å; P45-P47 WeakPolarHBondContact O-CD 3.44Å
46	V	77.4	Confident	70.4	Confident	69 Å²	69	106.8 Å²	106.8	42%	0.418	60%	0.598	S	S	.	*	P	Polyproline II helix	trans	-73.1	122.9	176.5	-174.1	0	0	0	0	107.7	V44 I48 L58 A59 T60	V44-V46 PolarHBondContact O-N 2.9Å; V44-V46 VanDerWaalsContact O-N 3.07Å; V46-I48 PolarHBondContact O-N 3.09Å; V46-L58 HydrophobicContact CB-CD2 4.24Å; V46-L58 HydrophobicContact CG1-CB 4.33Å; V46-L58 HydrophobicContact CG1-CD2 4.29Å; V46-A59 HydrophobicContact CG1-CB 4.05Å; V46-T60 HydrophobicContact CG1-CG2 4.2Å
47	P	80.5	Confident	71.6	Confident	65 Å²	65	104.5 Å²	104.5	42%	0.422	58%	0.575	S	S	.	*	P	Polyproline II helix	trans	-62.7	136.2	-177.3	18.3	-25.1	0	0	0	110.8	P45 Y49 A59	P45-P47 WeakPolarHBondContact O-CD 3.44Å; P47-Y49 HydrophobicContact CB-CE2 3.91Å; P47-Y49 HydrophobicContact CG-CE2 4.08Å; P47-A59 HydrophobicContact CG-CB 4.01Å; P47-A59 PolarHBondContact O-N 3.08Å
48	I	83.2	Confident	73.1	Confident	104 Å²	104	102 Å²	102	53%	0.533	56%	0.555	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.3	127.2	177.2	-67.4	172.7	0	0	0	108	V46 T56 L58	V46-I48 PolarHBondContact O-N 3.09Å; I48-T56 HydrophobicContact CG2-CG2 3.16Å; I48-L58 HydrophobicContact CD1-CD2 4.43Å; I48-L58 HydrophobicContact CG1-CD2 3.73Å
49	Y	80.8	Confident	74.1	Confident	56 Å²	56	97.6 Å²	97.6	22%	0.22	53%	0.528	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	156.6	175	-60	-77.1	0	0	0	110.5	P47 P51 R57 A59 L62 I70 I74 M131	P47-Y49 HydrophobicContact CB-CE2 3.91Å; P47-Y49 HydrophobicContact CG-CE2 4.08Å; Y49-P51 WeakPolarHBondContact O-CD 3.19Å; Y49-R57 PolarHBondContact N-O 2.92Å; Y49-R57 PolarHBondContact O-N 3.41Å; Y49-A59 HydrophobicContact CD2-CB 4.26Å; Y49-A59 HydrophobicContact CE2-CB 3.83Å; Y49-L62 HydrophobicContact CD2-CD1 3.81Å; Y49-L62 HydrophobicContact CG-CD1 4.42Å; Y49-I70 HydrophobicContact CD1-CD1 4.45Å; Y49-I70 HydrophobicContact CD1-CG2 3.88Å; Y49-I70 HydrophobicContact CD2-CD1 4.4Å; Y49-I70 HydrophobicContact CE1-CG2 3.71Å; Y49-I70 HydrophobicContact CG-CD1 4.06Å; Y49-I70 HydrophobicContact CG-CG2 4.43Å; Y49-I74 HydrophobicContact CE1-CD1 4.3Å; Y49-M131 HydrophobicContact CD1-CE 4.33Å
50	H	81.4	Confident	75.1	Confident	63 Å²	63	97.4 Å²	97.4	29%	0.292	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	81.6	178.7	46.1	-91.7	0	0	0	109.9	T52 Q55 R132	H50-T52 PolarHBondContact O-N 3.46Å; H50-Q55 WeakPolarHBondContact CA-O 3.48Å; H50-R132 PolarHBondContact CD2-NE 2.9Å; H50-R132 PolarHBondContact NE2-NE 3.4Å; H50-R132 VanDerWaalsContact NE2-NE 3.12Å; H50-R132 PolarHBondContact NE2-NH2 2.98Å
51	P	67	Low	76.3	Confident	38 Å²	38	93.3 Å²	93.3	25%	0.247	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.6	-27.8	-177.1	-20.1	32.3	0	0	0	113.3	Y49 Q55 L62	Y49-P51 WeakPolarHBondContact O-CD 3.19Å; P51-Q55 WeakPolarHBondContact CD-O 3.28Å; P51-L62 HydrophobicContact CG-CD2 3.91Å
52	T	68.9	Low	77.4	Confident	63 Å²	63	85.7 Å²	85.7	39%	0.387	48%	0.477	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	159.9	174.9	64	0	0	0	0	110.1	H50 S54 Q55	H50-T52 PolarHBondContact O-N 3.46Å; T52-S54 PolarHBondContact O-N 2.9Å; T52-Q55 PolarHBondContact O-N 2.75Å; T52-Q55 VanDerWaalsContact O-N 3.16Å; T52-Q55 WeakPolarHBondContact OG1-CB 3.5Å
53	P	74.3	Confident	78.6	Confident	120 Å²	120	81.6 Å²	81.6	78%	0.779	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	-24.5	-178.3	-27	35.4	0	0	0	114.9
54	S	77.8	Confident	79.9	Confident	119 Å²	119	80.4 Å²	80.4	83%	0.832	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.6	-0.3	-175.2	-40.5	0	0	0	0	113.8	T52	T52-S54 PolarHBondContact O-N 2.9Å
55	Q	78.6	Confident	81	Confident	80 Å²	80	80.1 Å²	80.1	37%	0.374	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	113.2	-169.4	-159.4	-178.9	17.9	0	0	111.5	H50 P51 T52 R57	H50-Q55 WeakPolarHBondContact CA-O 3.48Å; P51-Q55 WeakPolarHBondContact CD-O 3.28Å; T52-Q55 PolarHBondContact O-N 2.75Å; T52-Q55 VanDerWaalsContact O-N 3.16Å; T52-Q55 WeakPolarHBondContact OG1-CB 3.5Å; Q55-R57 HydrophobicContact CG-CG 3.91Å
56	T	81.4	Confident	81.6	Confident	104 Å²	104	76 Å²	76	64%	0.638	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.3	124.9	170	-54	0	0	0	0	108.4	I48	I48-T56 HydrophobicContact CG2-CG2 3.16Å
57	R	79.8	Confident	82.2	Confident	64 Å²	64	76.7 Å²	76.7	24%	0.242	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	139.4	177.5	-58.7	-169.4	81.5	169.6	5.2	110.9	Y49 Q55 Q61 L62 E66	Y49-R57 PolarHBondContact N-O 2.92Å; Y49-R57 PolarHBondContact O-N 3.41Å; Q55-R57 HydrophobicContact CG-CG 3.91Å; R57-Q61 PolarHBondContact NE-O 3.41Å; R57-Q61 PolarHBondContact NH2-O 2.93Å; R57-L62 HydrophobicContact CB-CD2 3.93Å; R57-L62 HydrophobicContact CB-CG 4.48Å; R57-L62 HydrophobicContact CG-CD2 4.48Å; R57-E66 IonicContact NH1-OE1 3.62Å; R57-E66 IonicContact NH1-OE2 3.43Å; R57-E66 PolarHBondContact NH1-OE2 3.29Å
58	L	84.7	Confident	82.7	Confident	62 Å²	62	78 Å²	78	33%	0.325	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.6	149.5	168	-66.7	168.4	0	0	0	109.5	V46 I48 T60 Q61	V46-L58 HydrophobicContact CB-CD2 4.24Å; V46-L58 HydrophobicContact CG1-CB 4.33Å; V46-L58 HydrophobicContact CG1-CD2 4.29Å; I48-L58 HydrophobicContact CD1-CD2 4.43Å; I48-L58 HydrophobicContact CG1-CD2 3.73Å; L58-T60 PolarHBondContact O-N 2.74Å; L58-T60 VanDerWaalsContact O-N 3.09Å; L58-Q61 HydrophobicContact CB-CG 4.2Å; L58-Q61 WeakPolarHBondContact O-CB 3.41Å; L58-Q61 PolarHBondContact O-N 3.45Å
59	A	79.2	Confident	83	Confident	21 Å²	21	79 Å²	79	17%	0.174	42%	0.417	C	S	.	.	G	3₁₀ helix	trans	-50.2	-37	176.1	0	0	0	0	0	113.4	V46 P47 Y49 Q61 L62 Q67	V46-A59 HydrophobicContact CG1-CB 4.05Å; P47-A59 HydrophobicContact CG-CB 4.01Å; P47-A59 PolarHBondContact O-N 3.08Å; Y49-A59 HydrophobicContact CD2-CB 4.26Å; Y49-A59 HydrophobicContact CE2-CB 3.83Å; A59-Q61 PolarHBondContact O-N 3.18Å; A59-L62 PolarHBondContact O-N 3.29Å; A59-Q67 PolarHBondContact O-NE2 2.85Å
60	T	83.1	Confident	83.5	Confident	107 Å²	107	77.4 Å²	77.4	66%	0.656	41%	0.412	S	S	*	.	G	3₁₀ helix	trans	-70.7	-14	179.6	52.3	0	0	0	0	114.5	V46 L58	V46-T60 HydrophobicContact CG1-CG2 4.2Å; L58-T60 PolarHBondContact O-N 2.74Å; L58-T60 VanDerWaalsContact O-N 3.09Å
61	Q	86.4	Confident	84	Confident	99 Å²	99	77.2 Å²	77.2	46%	0.463	42%	0.422	S	S	.	.	G	3₁₀ helix	trans	-101.6	0	-177.7	-64	174.2	-6.3	0	0	112.7	R57 L58 A59	R57-Q61 PolarHBondContact NE-O 3.41Å; R57-Q61 PolarHBondContact NH2-O 2.93Å; L58-Q61 HydrophobicContact CB-CG 4.2Å; L58-Q61 WeakPolarHBondContact O-CB 3.41Å; L58-Q61 PolarHBondContact O-N 3.45Å; A59-Q61 PolarHBondContact O-N 3.18Å
62	L	85.5	Confident	85.2	Confident	14 Å²	14	81.5 Å²	81.5	7%	0.073	44%	0.438	C	S	.	.	S	Bend	trans	-87	147.4	-179.4	-65.1	171.1	0	0	0	110.9	Y49 P51 R57 A59 E66 Q67 I70	Y49-L62 HydrophobicContact CD2-CD1 3.81Å; Y49-L62 HydrophobicContact CG-CD1 4.42Å; P51-L62 HydrophobicContact CG-CD2 3.91Å; R57-L62 HydrophobicContact CB-CD2 3.93Å; R57-L62 HydrophobicContact CB-CG 4.48Å; R57-L62 HydrophobicContact CG-CD2 4.48Å; A59-L62 PolarHBondContact O-N 3.29Å; L62-E66 VanDerWaalsContact CA-OE2 3.28Å; L62-E66 WeakPolarHBondContact CA-OE2 3.25Å; L62-E66 HydrophobicContact CB-CB 3.97Å; L62-E66 HydrophobicContact CD2-CB 4.11Å; L62-E66 WeakPolarHBondContact CD2-OE2 3.43Å; L62-Q67 HydrophobicContact CB-CG 3.73Å; L62-Q67 HydrophobicContact CD1-CG 4.3Å; L62-I70 HydrophobicContact CD1-CD1 3.49Å; L62-I70 VanDerWaalsContact CD1-CD1 3.49Å
63	T	91.8	Very high	86.3	Confident	64 Å²	64	81.6 Å²	81.6	39%	0.393	43%	0.431	S	S	.	.			trans	-67.9	159.8	168.7	82.5	0	0	0	0	110.5	E65 E66 Q67	T63-E65 VanDerWaalsContact CB-OE2 3.25Å; T63-E65 WeakPolarHBondContact CB-OE2 3.28Å; T63-E65 PolarHBondContact O-N 3.32Å; T63-E65 PolarHBondContact OG1-N 3.44Å; T63-E65 PolarHBondContact OG1-OE2 2.92Å; T63-E66 PolarHBondContact N-OE2 3.02Å; T63-E66 WeakPolarHBondContact O-CB 3.31Å; T63-E66 PolarHBondContact O-N 2.89Å; T63-E66 VanDerWaalsContact O-N 3.08Å; T63-E66 PolarHBondContact OG1-N 3.28Å; T63-Q67 WeakPolarHBondContact O-CG 3.46Å; T63-Q67 PolarHBondContact O-N 2.85Å
64	E	90.9	Very high	87.2	Confident	145 Å²	145	78.2 Å²	78.2	68%	0.678	41%	0.406	S	S	*	.	H	α-helix	trans	-57	-39.8	176.3	-67.4	-178	179.1	0	0	111.1	E66 Q67 I68	E64-E66 PolarHBondContact O-N 3.49Å; E64-Q67 PolarHBondContact O-N 3.01Å; E64-I68 WeakPolarHBondContact O-CB 3.48Å; E64-I68 WeakPolarHBondContact O-CD1 3.45Å; E64-I68 WeakPolarHBondContact O-CG1 3.35Å; E64-I68 PolarHBondContact O-N 2.92Å
65	E	91.1	Very high	88.1	Confident	109 Å²	109	73.9 Å²	73.9	51%	0.509	38%	0.381	S	S	.	.	H	α-helix	trans	-65.8	-38.4	176.9	-54.2	76.7	-166.7	0	0	111.9	T63 R69	T63-E65 VanDerWaalsContact CB-OE2 3.25Å; T63-E65 WeakPolarHBondContact CB-OE2 3.28Å; T63-E65 PolarHBondContact O-N 3.32Å; T63-E65 PolarHBondContact OG1-N 3.44Å; T63-E65 PolarHBondContact OG1-OE2 2.92Å; E65-R69 VanDerWaalsContact O-CG 3.31Å; E65-R69 WeakPolarHBondContact O-CG 3.44Å; E65-R69 PolarHBondContact O-N 3.43Å
66	E	89.8	Confident	88.8	Confident	29 Å²	29	72.2 Å²	72.2	14%	0.136	37%	0.374	C	S	.	.	H	α-helix	trans	-62.9	-45.3	173.9	-75.8	174.8	148.9	0	0	111.3	R57 L62 T63 E64 R69 I70	R57-E66 IonicContact NH1-OE1 3.62Å; R57-E66 IonicContact NH1-OE2 3.43Å; R57-E66 PolarHBondContact NH1-OE2 3.29Å; L62-E66 VanDerWaalsContact CA-OE2 3.28Å; L62-E66 WeakPolarHBondContact CA-OE2 3.25Å; L62-E66 HydrophobicContact CB-CB 3.97Å; L62-E66 HydrophobicContact CD2-CB 4.11Å; L62-E66 WeakPolarHBondContact CD2-OE2 3.43Å; T63-E66 PolarHBondContact N-OE2 3.02Å; T63-E66 WeakPolarHBondContact O-CB 3.31Å; T63-E66 PolarHBondContact O-N 2.89Å; T63-E66 VanDerWaalsContact O-N 3.08Å; T63-E66 PolarHBondContact OG1-N 3.28Å; E64-E66 PolarHBondContact O-N 3.49Å; E66-R69 VanDerWaalsContact CG-NH2 3.27Å; E66-R69 PolarHBondContact O-N 3.47Å; E66-I70 WeakPolarHBondContact O-CD1 3.49Å; E66-I70 WeakPolarHBondContact O-CG1 3.26Å; E66-I70 PolarHBondContact O-N 3.39Å
67	Q	89.2	Confident	89.5	Confident	85 Å²	85	67.7 Å²	67.7	40%	0.397	35%	0.346	S	S	.	.	H	α-helix	trans	-62.9	-43.8	177.1	-69.1	178.2	-12.6	0	0	111.8	A59 L62 T63 E64 R69 I70 A71	A59-Q67 PolarHBondContact O-NE2 2.85Å; L62-Q67 HydrophobicContact CB-CG 3.73Å; L62-Q67 HydrophobicContact CD1-CG 4.3Å; T63-Q67 WeakPolarHBondContact O-CG 3.46Å; T63-Q67 PolarHBondContact O-N 2.85Å; E64-Q67 PolarHBondContact O-N 3.01Å; Q67-R69 PolarHBondContact O-N 3.47Å; Q67-I70 PolarHBondContact O-N 3.35Å; Q67-A71 WeakPolarHBondContact O-CB 3.3Å; Q67-A71 PolarHBondContact O-N 3.28Å
68	I	91.2	Very high	90.2	Very high	91 Å²	91	71.1 Å²	71.1	47%	0.467	36%	0.364	S	S	.	.	H	α-helix	trans	-60.3	-46.6	176.9	-70.9	163.6	0	0	0	110.5	E64 I70 A71 Q72	E64-I68 WeakPolarHBondContact O-CB 3.48Å; E64-I68 WeakPolarHBondContact O-CD1 3.45Å; E64-I68 WeakPolarHBondContact O-CG1 3.35Å; E64-I68 PolarHBondContact O-N 2.92Å; I68-I70 VanDerWaalsContact C-N 3.33Å; I68-I70 PolarHBondContact O-N 3.43Å; I68-A71 PolarHBondContact O-N 3.44Å; I68-Q72 HydrophobicContact CG2-CG 4.4Å; I68-Q72 WeakPolarHBondContact O-CB 3.34Å; I68-Q72 VanDerWaalsContact O-CG 3.28Å; I68-Q72 WeakPolarHBondContact O-CG 3.49Å; I68-Q72 PolarHBondContact O-N 3.02Å
69	R	89.8	Confident	90.7	Very high	126 Å²	126	75.9 Å²	75.9	48%	0.475	39%	0.385	S	S	.	.	H	α-helix	trans	-61.9	-41.2	177.7	-72.5	-170.2	-48.8	-107.2	6.3	112.1	E65 E66 Q67 Q72 R73	E65-R69 VanDerWaalsContact O-CG 3.31Å; E65-R69 WeakPolarHBondContact O-CG 3.44Å; E65-R69 PolarHBondContact O-N 3.43Å; E66-R69 VanDerWaalsContact CG-NH2 3.27Å; E66-R69 PolarHBondContact O-N 3.47Å; Q67-R69 PolarHBondContact O-N 3.47Å; R69-Q72 PolarHBondContact O-N 2.94Å; R69-R73 WeakPolarHBondContact O-CG 3.37Å; R69-R73 PolarHBondContact O-N 2.9Å
70	I	90.7	Very high	91.5	Very high	22 Å²	22	75.5 Å²	75.5	11%	0.113	38%	0.38	C	S	.	.	H	α-helix	trans	-64	-47	177.3	-73.9	162.9	0	0	0	110.4	Y49 L62 E66 Q67 I68 Q72 R73 I74 M131	Y49-I70 HydrophobicContact CD1-CD1 4.45Å; Y49-I70 HydrophobicContact CD1-CG2 3.88Å; Y49-I70 HydrophobicContact CD2-CD1 4.4Å; Y49-I70 HydrophobicContact CE1-CG2 3.71Å; Y49-I70 HydrophobicContact CG-CD1 4.06Å; Y49-I70 HydrophobicContact CG-CG2 4.43Å; L62-I70 HydrophobicContact CD1-CD1 3.49Å; L62-I70 VanDerWaalsContact CD1-CD1 3.49Å; E66-I70 WeakPolarHBondContact O-CD1 3.49Å; E66-I70 WeakPolarHBondContact O-CG1 3.26Å; E66-I70 PolarHBondContact O-N 3.39Å; Q67-I70 PolarHBondContact O-N 3.35Å; I68-I70 VanDerWaalsContact C-N 3.33Å; I68-I70 PolarHBondContact O-N 3.43Å; I70-Q72 VanDerWaalsContact C-N 3.35Å; I70-Q72 PolarHBondContact O-N 3.24Å; I70-R73 PolarHBondContact O-N 3.39Å; I70-I74 HydrophobicContact CG2-CD1 3.72Å; I70-I74 HydrophobicContact CG2-CG1 4.42Å; I70-I74 VanDerWaalsContact O-CG1 3.3Å; I70-I74 WeakPolarHBondContact O-CG1 3.1Å; I70-I74 PolarHBondContact O-N 3.29Å; I70-M131 HydrophobicContact CG2-CE 4.23Å
71	A	92.3	Very high	92.2	Very high	60 Å²	60	74.2 Å²	74.2	50%	0.496	37%	0.373	S	S	.	.	H	α-helix	trans	-61.2	-42.6	178.4	0	0	0	0	0	112.2	Q67 I68 I74 G75	Q67-A71 WeakPolarHBondContact O-CB 3.3Å; Q67-A71 PolarHBondContact O-N 3.28Å; I68-A71 PolarHBondContact O-N 3.44Å; A71-I74 PolarHBondContact O-N 3.03Å; A71-G75 PolarHBondContact O-N 3.5Å
72	Q	91.9	Very high	92.7	Very high	128 Å²	128	76.9 Å²	76.9	60%	0.598	38%	0.383	S	S	*	.	H	α-helix	trans	-61	-45.7	175.5	-74.2	172.4	-4	0	0	112.1	I68 R69 I70 G75 L76	I68-Q72 HydrophobicContact CG2-CG 4.4Å; I68-Q72 WeakPolarHBondContact O-CB 3.34Å; I68-Q72 VanDerWaalsContact O-CG 3.28Å; I68-Q72 WeakPolarHBondContact O-CG 3.49Å; I68-Q72 PolarHBondContact O-N 3.02Å; R69-Q72 PolarHBondContact O-N 2.94Å; I70-Q72 VanDerWaalsContact C-N 3.35Å; I70-Q72 PolarHBondContact O-N 3.24Å; Q72-G75 PolarHBondContact O-N 3.28Å; Q72-L76 PolarHBondContact O-N 3.16Å
73	R	93.1	Very high	93.1	Very high	64 Å²	64	77.5 Å²	77.5	24%	0.242	39%	0.393	C	S	.	.	H	α-helix	trans	-60.3	-48.9	175.9	-74.5	-179.3	176.8	-176.1	-3.7	111.7	R69 I70 G75 L76 I77 M131 R132 F134	R69-R73 WeakPolarHBondContact O-CG 3.37Å; R69-R73 PolarHBondContact O-N 2.9Å; I70-R73 PolarHBondContact O-N 3.39Å; R73-G75 VanDerWaalsContact C-N 3.3Å; R73-G75 PolarHBondContact O-N 3.23Å; R73-L76 PolarHBondContact O-N 2.99Å; R73-I77 HydrophobicContact CB-CD1 4.5Å; R73-I77 WeakPolarHBondContact O-CB 3.45Å; R73-I77 WeakPolarHBondContact O-CD1 3.46Å; R73-I77 WeakPolarHBondContact O-CG1 3.2Å; R73-I77 PolarHBondContact O-N 3.43Å; R73-M131 PolarHBondContact NH1-O 3.03Å; R73-R132 PolarHBondContact NH1-O 2.79Å; R73-F134 HydrophobicContact CB-CD2 4.43Å; R73-F134 HydrophobicContact CB-CE2 4.18Å; R73-F134 HydrophobicContact CG-CD2 3.78Å; R73-F134 HydrophobicContact CG-CE2 3.88Å; R73-F134 HydrophobicContact CG-CG 4.38Å
74	I	94.1	Very high	93.3	Very high	50 Å²	50	78.9 Å²	78.9	26%	0.256	40%	0.401	S	S	.	.	H	α-helix	trans	-56.8	-47.3	178	-69.4	168.7	0	0	0	110.2	Y49 I70 A71 L76 I77 Q78 M131	Y49-I74 HydrophobicContact CE1-CD1 4.3Å; I70-I74 HydrophobicContact CG2-CD1 3.72Å; I70-I74 HydrophobicContact CG2-CG1 4.42Å; I70-I74 VanDerWaalsContact O-CG1 3.3Å; I70-I74 WeakPolarHBondContact O-CG1 3.1Å; I70-I74 PolarHBondContact O-N 3.29Å; A71-I74 PolarHBondContact O-N 3.03Å; I74-L76 PolarHBondContact O-N 3.31Å; I74-I77 PolarHBondContact O-N 2.75Å; I74-Q78 HydrophobicContact CG2-CG 4.47Å; I74-Q78 WeakPolarHBondContact O-CB 3.38Å; I74-Q78 VanDerWaalsContact O-CG 3.26Å; I74-Q78 WeakPolarHBondContact O-CG 3.48Å; I74-Q78 PolarHBondContact O-N 3.07Å; I74-M131 HydrophobicContact CD1-CE 4.29Å; I74-M131 HydrophobicContact CG1-CE 3.95Å; I74-M131 HydrophobicContact CG1-SD 3.75Å
75	G	95.1	Very high	93.4	Very high	28 Å²	28	72.4 Å²	72.4	29%	0.289	37%	0.37	S	S	.	.	H	α-helix	trans	-59.6	-45.2	178.8	0	0	0	0	0	112.7	A71 Q72 R73 H79	A71-G75 PolarHBondContact O-N 3.5Å; Q72-G75 PolarHBondContact O-N 3.28Å; R73-G75 VanDerWaalsContact C-N 3.3Å; R73-G75 PolarHBondContact O-N 3.23Å; G75-H79 PolarHBondContact O-CD2 2.98Å; G75-H79 VanDerWaalsContact O-CD2 3.28Å; G75-H79 PolarHBondContact O-N 3.03Å
76	L	93.6	Very high	93.4	Very high	45 Å²	45	70 Å²	70	24%	0.236	36%	0.361	C	S	.	.	H	α-helix	trans	-66.8	-47	178.5	-168.3	138.6	0	0	0	111.8	Q72 R73 I74 Q78 H79 L80 F134 V143	Q72-L76 PolarHBondContact O-N 3.16Å; R73-L76 PolarHBondContact O-N 2.99Å; I74-L76 PolarHBondContact O-N 3.31Å; L76-Q78 VanDerWaalsContact C-N 3.26Å; L76-Q78 PolarHBondContact O-N 3.29Å; L76-H79 PolarHBondContact O-N 3.18Å; L76-L80 HydrophobicContact CD2-CD1 4.03Å; L76-L80 HydrophobicContact CD2-CD2 3.99Å; L76-L80 HydrophobicContact CD2-CG 3.87Å; L76-L80 PolarHBondContact O-N 3.49Å; L76-L80 VanDerWaalsContact O-N 3.07Å; L76-F134 HydrophobicContact CB-CE2 4.21Å; L76-F134 HydrophobicContact CB-CZ 3.65Å; L76-F134 HydrophobicContact CD1-CE1 4.02Å; L76-F134 HydrophobicContact CD1-CZ 3.63Å; L76-F134 HydrophobicContact CD2-CE1 4.34Å; L76-F134 HydrophobicContact CD2-CE2 3.89Å; L76-F134 HydrophobicContact CD2-CZ 3.47Å; L76-F134 VanDerWaalsContact CD2-CZ 3.47Å; L76-F134 HydrophobicContact CG-CE2 4.45Å; L76-F134 HydrophobicContact CG-CZ 3.71Å; L76-V143 HydrophobicContact CD2-CG1 4Å; L76-V143 WeakPolarHBondContact CD2-O 3.4Å
77	I	96	Very high	93.1	Very high	9 Å²	9	71.7 Å²	71.7	5%	0.046	38%	0.375	C	S	.	.	H	α-helix	trans	-57.3	-41.9	179.6	-66.6	163.6	0	0	0	110.6	R73 I74 H79 L80 R113 D127 L130 M131	R73-I77 HydrophobicContact CB-CD1 4.5Å; R73-I77 WeakPolarHBondContact O-CB 3.45Å; R73-I77 WeakPolarHBondContact O-CD1 3.46Å; R73-I77 WeakPolarHBondContact O-CG1 3.2Å; R73-I77 PolarHBondContact O-N 3.43Å; I74-I77 PolarHBondContact O-N 2.75Å; I77-H79 PolarHBondContact O-N 3.41Å; I77-L80 PolarHBondContact O-N 3.12Å; I77-R113 PolarHBondContact O-NH1 3.11Å; I77-R113 PolarHBondContact O-NH2 3.04Å; I77-D127 HydrophobicContact CG2-CB 4.12Å; I77-D127 VanDerWaalsContact CG2-CG 3.48Å; I77-D127 WeakPolarHBondContact CG2-OD1 3.41Å; I77-L130 HydrophobicContact CD1-CB 3.56Å; I77-L130 HydrophobicContact CG1-CB 3.75Å; I77-L130 HydrophobicContact CG1-CD1 4.03Å; I77-M131 HydrophobicContact CD1-CG 4.02Å; I77-M131 HydrophobicContact CD1-SD 3.78Å
78	Q	95.6	Very high	92.6	Very high	135 Å²	135	71 Å²	71	63%	0.631	39%	0.39	S	S	*	.	H	α-helix	trans	-62.5	-27.2	177.9	-74.5	177.2	5.9	0	0	113.8	I74 L76	I74-Q78 HydrophobicContact CG2-CG 4.47Å; I74-Q78 WeakPolarHBondContact O-CB 3.38Å; I74-Q78 VanDerWaalsContact O-CG 3.26Å; I74-Q78 WeakPolarHBondContact O-CG 3.48Å; I74-Q78 PolarHBondContact O-N 3.07Å; L76-Q78 VanDerWaalsContact C-N 3.26Å; L76-Q78 PolarHBondContact O-N 3.29Å
79	H	95.4	Very high	91.8	Very high	162 Å²	162	76.7 Å²	76.7	75%	0.75	41%	0.406	S	S	*	.	H	α-helix	trans	-97.4	-8.1	-178.7	-69.8	-39.5	0	0	0	114.6	G75 L76 I77	G75-H79 PolarHBondContact O-CD2 2.98Å; G75-H79 VanDerWaalsContact O-CD2 3.28Å; G75-H79 PolarHBondContact O-N 3.03Å; L76-H79 PolarHBondContact O-N 3.18Å; I77-H79 PolarHBondContact O-N 3.41Å
80	L	96.1	Very high	90.6	Very high	13 Å²	13	73.3 Å²	73.3	7%	0.068	40%	0.397	C	S	.	.	S	Bend	trans	-60.3	140	171.5	-73.7	173.8	0	0	0	111	L76 I77 K82 R113 L115 P116 L130 V143	L76-L80 HydrophobicContact CD2-CD1 4.03Å; L76-L80 HydrophobicContact CD2-CD2 3.99Å; L76-L80 HydrophobicContact CD2-CG 3.87Å; L76-L80 PolarHBondContact O-N 3.49Å; L76-L80 VanDerWaalsContact O-N 3.07Å; I77-L80 PolarHBondContact O-N 3.12Å; L80-K82 PolarHBondContact O-N 3.08Å; L80-R113 HydrophobicContact CB-CG 4.11Å; L80-R113 PolarHBondContact O-NH1 2.97Å; L80-L115 HydrophobicContact CD1-CD2 3.86Å; L80-P116 HydrophobicContact CD2-CG 4.11Å; L80-L130 HydrophobicContact CD1-CD1 3.55Å; L80-V143 HydrophobicContact CD1-CG1 3.98Å; L80-V143 HydrophobicContact CD2-CG1 4Å
81	P	96.5	Very high	89	Confident	80 Å²	80	76.6 Å²	76.6	52%	0.519	44%	0.436	S	S	.	.			trans	-59.5	132.9	179.6	-20.5	30.1	0	0	0	111.9	R113 F114	P81-R113 WeakPolarHBondContact O-CG 3.33Å; P81-F114 HydrophobicContact CB-CB 4.25Å; P81-F114 HydrophobicContact CB-CD2 4.39Å; P81-F114 PolarHBondContact O-N 3.29Å
82	K	96.6	Very high	87.2	Confident	155 Å²	155	76.8 Å²	76.8	67%	0.674	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.3	156.5	175.4	63.9	-178.2	179.5	-177.9	0	110.8	L80 I112 L123	L80-K82 PolarHBondContact O-N 3.08Å; K82-I112 CarbonylContact C-O 3.58Å; K82-I112 WeakPolarHBondContact CA-O 3.36Å; K82-L123 HydrophobicContact CB-CD1 4.1Å; K82-L123 HydrophobicContact CD-CD1 4.24Å
83	G	94.9	Very high	85.4	Confident	27 Å²	27	80 Å²	80	28%	0.278	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.2	-165	177.7	0	0	0	0	0	112.3	I112	G83-I112 PolarHBondContact N-O 3.39Å; G83-I112 PolarHBondContact O-N 3.45Å
84	V	95.2	Very high	83.7	Confident	93 Å²	93	86.4 Å²	86.4	56%	0.564	48%	0.478	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.2	134.3	178.2	174.6	0	0	0	0	107.7	D86 D110	V84-D86 PolarHBondContact O-N 2.94Å; V84-D110 CarbonylContact C-O 3.6Å; V84-D110 WeakPolarHBondContact CA-O 3.23Å
85	Y	94.1	Very high	82.3	Confident	9 Å²	9	85.6 Å²	85.6	4%	0.035	47%	0.473	C	S	.	.			trans	-67.7	129.6	175.2	-175.9	-104.1	0	0	0	110.4	P87 F106 V107 Y108 G109 D110 I112	Y85-P87 HydrophobicContact CE1-CB 3.87Å; Y85-P87 HydrophobicContact CE1-CG 4.11Å; Y85-F106 HydrophobicContact CD1-CB 3.53Å; Y85-F106 HydrophobicContact CD2-CB 3.77Å; Y85-F106 HydrophobicContact CD2-CD2 4.33Å; Y85-F106 HydrophobicContact CD2-CG 4.07Å; Y85-F106 HydrophobicContact CE1-CB 3.58Å; Y85-F106 HydrophobicContact CE2-CB 3.84Å; Y85-F106 HydrophobicContact CE2-CD2 4.15Å; Y85-F106 HydrophobicContact CE2-CG 4.22Å; Y85-F106 HydrophobicContact CG-CB 3.62Å; Y85-F106 HydrophobicContact CG-CG 4.27Å; Y85-V107 WeakPolarHBondContact CD1-O 3.38Å; Y85-Y108 WeakPolarHBondContact O-CA 3.23Å; Y85-G109 PolarHBondContact O-N 3.49Å; Y85-D110 PolarHBondContact N-O 2.94Å; Y85-I112 HydrophobicContact CD2-CD1 4.45Å
86	D	91.1	Very high	81	Confident	60 Å²	60	88.2 Å²	88.2	32%	0.321	48%	0.48	S	S	.	.			trans	-137	102.9	175.8	-179.4	-7	0	0	0	109.6	V84 G88 R89 Y108	V84-D86 PolarHBondContact O-N 2.94Å; D86-G88 PolarHBondContact O-N 2.8Å; D86-G88 PolarHBondContact OD1-N 2.74Å; D86-R89 HydrophobicContact CB-CB 4.13Å; D86-R89 PolarHBondContact O-N 3.27Å; D86-R89 VanDerWaalsContact O-N 3.13Å; D86-Y108 HydrophobicContact CB-CD2 4.15Å; D86-Y108 HydrophobicContact CB-CE2 4.14Å
87	P	82.9	Confident	80.6	Confident	64 Å²	64	93 Å²	93	42%	0.416	50%	0.495	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.9	-7.1	-177.8	28.4	-33.5	0	0	0	113.7	Y85 K95	Y85-P87 HydrophobicContact CE1-CB 3.87Å; Y85-P87 HydrophobicContact CE1-CG 4.11Å; P87-K95 PolarHBondContact O-NZ 3.09Å
88	G	78.9	Confident	80.4	Confident	69 Å²	69	96.5 Å²	96.5	71%	0.711	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.5	-15	174.6	0	0	0	0	0	114.4	D86	D86-G88 PolarHBondContact O-N 2.8Å; D86-G88 PolarHBondContact OD1-N 2.74Å
89	R	74.7	Confident	80.5	Confident	212 Å²	212	90.1 Å²	90.1	80%	0.8	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.9	-31.7	-171.4	-169.5	174.8	-174.6	-141.7	-0	113.7	D86	D86-R89 HydrophobicContact CB-CB 4.13Å; D86-R89 PolarHBondContact O-N 3.27Å; D86-R89 VanDerWaalsContact O-N 3.13Å
90	D	63.7	Low	80.5	Confident	54 Å²	54	85.6 Å²	85.6	29%	0.289	47%	0.465	S	S	.	.			trans	-96.5	104	-174.6	30.6	-12.6	0	0	0	109	S92 K95	D90-S92 PolarHBondContact O-N 2.61Å; D90-K95 HydrophobicContact CB-CD 4.29Å; D90-K95 VanDerWaalsContact CB-CE 3.46Å; D90-K95 HydrophobicContact CB-CG 4.48Å; D90-K95 WeakPolarHBondContact O-CE 3.39Å; D90-K95 PolarHBondContact O-NZ 2.92Å; D90-K95 WeakPolarHBondContact OD1-CE 3.44Å; D90-K95 IonicContact OD1-NZ 3.72Å; D90-K95 PolarHBondContact OD1-NZ 2.87Å; D90-K95 WeakPolarHBondContact OD2-CD 3.34Å; D90-K95 WeakPolarHBondContact OD2-CE 3.48Å; D90-K95 VanDerWaalsContact OD2-CG 3.3Å; D90-K95 WeakPolarHBondContact OD2-CG 3.36Å; D90-K95 IonicContact OD2-NZ 3.19Å; D90-K95 PolarHBondContact OD2-NZ 2.9Å
91	G	56.8	Low	80.5	Confident	91 Å²	91	87.5 Å²	87.5	94%	0.938	47%	0.474	S	S	*	.			trans	-72.5	15.3	-177.8	0	0	0	0	0	115.1
92	S	55.8	Low	80.6	Confident	65 Å²	65	85.5 Å²	85.5	46%	0.455	46%	0.462	S	S	.	.			trans	-101.5	130	-170.3	41.7	0	0	0	0	112.4	D90 K94 K95	D90-S92 PolarHBondContact O-N 2.61Å; S92-K94 PolarHBondContact O-N 3.3Å; S92-K95 WeakPolarHBondContact O-CE 3.27Å; S92-K95 WeakPolarHBondContact O-CG 3.39Å
93	E	54	Low	80.6	Confident	194 Å²	194	85.1 Å²	85.1	91%	0.907	46%	0.464	S	S	*	.	S	Bend	trans	-64.3	-18.1	177.4	-154.6	91.8	-148	0	0	113.1
94	K	57.1	Low	80.7	Confident	199 Å²	199	89.3 Å²	89.3	87%	0.865	48%	0.478	S	S	*	.			trans	-105.7	61.6	-177.8	-62.9	-174.1	-178.5	-176	0	111.8	S92	S92-K94 PolarHBondContact O-N 3.3Å
95	K	63.3	Low	80.6	Confident	34 Å²	34	90.1 Å²	90.1	15%	0.148	48%	0.479	C	S	.	.			trans	-85.6	129.6	175.1	-71.4	173.9	-168.1	-160	0	110.5	P87 D90 S92 R97	P87-K95 PolarHBondContact O-NZ 3.09Å; D90-K95 HydrophobicContact CB-CD 4.29Å; D90-K95 VanDerWaalsContact CB-CE 3.46Å; D90-K95 HydrophobicContact CB-CG 4.48Å; D90-K95 WeakPolarHBondContact O-CE 3.39Å; D90-K95 PolarHBondContact O-NZ 2.92Å; D90-K95 WeakPolarHBondContact OD1-CE 3.44Å; D90-K95 IonicContact OD1-NZ 3.72Å; D90-K95 PolarHBondContact OD1-NZ 2.87Å; D90-K95 WeakPolarHBondContact OD2-CD 3.34Å; D90-K95 WeakPolarHBondContact OD2-CE 3.48Å; D90-K95 VanDerWaalsContact OD2-CG 3.3Å; D90-K95 WeakPolarHBondContact OD2-CG 3.36Å; D90-K95 IonicContact OD2-NZ 3.19Å; D90-K95 PolarHBondContact OD2-NZ 2.9Å; S92-K95 WeakPolarHBondContact O-CE 3.27Å; S92-K95 WeakPolarHBondContact O-CG 3.39Å; K95-R97 HydrophobicContact CB-CG 3.83Å; K95-R97 WeakPolarHBondContact O-CG 3.41Å; K95-R97 PolarHBondContact O-N 3.36Å
96	I	69.2	Low	80.7	Confident	82 Å²	82	90.3 Å²	90.3	42%	0.421	48%	0.48	S	S	.	.			trans	-60.1	108.1	154.4	-60.7	171.5	0	0	0	105.2	E98 F106	I96-E98 WeakPolarHBondContact CG2-O 3.2Å; I96-F106 HydrophobicContact CG2-CE2 4.32Å
97	R	83.9	Confident	80.8	Confident	146 Å²	146	91.9 Å²	91.9	55%	0.551	49%	0.491	S	S	*	.			trans	-103	-1.6	-179.4	-64.6	-168.7	-173	-164.4	1.3	112.8	K95 D105 F106	K95-R97 HydrophobicContact CB-CG 3.83Å; K95-R97 WeakPolarHBondContact O-CG 3.41Å; K95-R97 PolarHBondContact O-N 3.36Å; R97-D105 CarbonylContact O-C 3.46Å; R97-D105 VanDerWaalsContact O-CA 3.24Å; R97-D105 WeakPolarHBondContact O-CA 3.43Å; R97-F106 VanDerWaalsContact C-CD2 3.45Å; R97-F106 WeakPolarHBondContact O-CD2 2.86Å; R97-F106 PolarHBondContact O-N 3.11Å
98	E	92.9	Very high	81.3	Confident	83 Å²	83	96.5 Å²	96.5	39%	0.388	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	139.5	-174.5	-173.3	-169.8	-126.5	0	0	110	I96 V100 M104 F106	I96-E98 WeakPolarHBondContact CG2-O 3.2Å; E98-V100 PolarHBondContact O-N 2.88Å; E98-M104 WeakPolarHBondContact CA-O 3.49Å; E98-M104 WeakPolarHBondContact CG-O 3.47Å; E98-F106 VanDerWaalsContact C-CE2 3.43Å; E98-F106 WeakPolarHBondContact O-CE2 3.48Å
99	C	96.9	Very high	82	Confident	0 Å²	0	95 Å²	95	0%	0	49%	0.487	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	111.9	167.4	-178.8	0	0	0	0	109.5	I101 C102 M103 M104 F106 H122	C99-I101 PolarHBondContact O-N 3.08Å; C99-C102 VanDerWaalsContact CB-SG 3.54Å; C99-C102 PolarHBondContact O-N 2.84Å; C99-M103 WeakPolarHBondContact O-CA 3.48Å; C99-M103 PolarHBondContact O-N 3.28Å; C99-M104 PolarHBondContact N-O 3.44Å; C99-F106 HydrophobicContact CB-CE1 3.71Å; C99-F106 HydrophobicContact CB-CE2 4.49Å; C99-F106 HydrophobicContact CB-CZ 3.67Å; C99-H122 WeakPolarHBondContact CB-ND1 3.46Å
100	V	96	Very high	83.1	Confident	68 Å²	68	86.7 Å²	86.7	41%	0.412	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-12.2	-177.3	-58.2	0	0	0	0	114.6	E98 Y121 P137	E98-V100 PolarHBondContact O-N 2.88Å; V100-Y121 HydrophobicContact CG2-CD1 4.13Å; V100-Y121 HydrophobicContact CG2-CE1 3.52Å; V100-P137 HydrophobicContact CG2-CB 4.48Å
101	I	96.9	Very high	84.7	Confident	53 Å²	53	87 Å²	87	27%	0.272	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.3	-47	177.6	-61.9	172.3	0	0	0	110.1	C99 Y121 C125 I126 W129 P137	C99-I101 PolarHBondContact O-N 3.08Å; I101-Y121 HydrophobicContact CD1-CD1 3.59Å; I101-Y121 HydrophobicContact CD1-CE1 4.22Å; I101-Y121 HydrophobicContact CD1-CG 4.08Å; I101-Y121 HydrophobicContact CG1-CD1 3.81Å; I101-Y121 HydrophobicContact CG1-CE1 4.22Å; I101-C125 HydrophobicContact CB-CB 4.01Å; I101-C125 HydrophobicContact CD1-CB 3.96Å; I101-C125 HydrophobicContact CG2-CB 3.92Å; I101-I126 HydrophobicContact CD1-CB 4.1Å; I101-I126 HydrophobicContact CD1-CD1 3.99Å; I101-W129 HydrophobicContact CD1-CB 4.26Å; I101-P137 HydrophobicContact CD1-CG 4.08Å; I101-P137 HydrophobicContact CG1-CG 4.16Å
102	C	97.6	Very high	86.6	Confident	37 Å²	37	82.9 Å²	82.9	25%	0.25	42%	0.42	C	S	.	.	T	Hydrogen-bonded Turn	trans	-102.6	-6.6	-176.9	66.6	0	0	0	0	113.6	C99 M104 H122	C99-C102 VanDerWaalsContact CB-SG 3.54Å; C99-C102 PolarHBondContact O-N 2.84Å; C102-M104 HydrophobicContact CB-CE 3.61Å; C102-M104 PolarHBondContact O-N 3.32Å; C102-H122 PolarHBondContact SG-ND1 3.42Å; C102-H122 VanDerWaalsContact SG-ND1 3.42Å
103	M	96	Very high	88.6	Confident	147 Å²	147	80.3 Å²	80.3	72%	0.724	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	56	35	-177.2	-52.7	178.7	-178.1	0	0	112.6	C99	C99-M103 WeakPolarHBondContact O-CA 3.48Å; C99-M103 PolarHBondContact O-N 3.28Å
104	M	96.6	Very high	90.6	Very high	115 Å²	115	74.3 Å²	74.3	57%	0.567	37%	0.371	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.3	140.5	176.5	-66.2	-174.2	-84.5	0	0	110.3	E98 C99 C102	E98-M104 WeakPolarHBondContact CA-O 3.49Å; E98-M104 WeakPolarHBondContact CG-O 3.47Å; C99-M104 PolarHBondContact N-O 3.44Å; C102-M104 HydrophobicContact CB-CE 3.61Å; C102-M104 PolarHBondContact O-N 3.32Å
105	D	95	Very high	92.4	Very high	110 Å²	110	65 Å²	65	59%	0.588	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-61.3	144.1	173.4	-73.3	-34.2	0	0	0	111.1	R97	R97-D105 CarbonylContact O-C 3.46Å; R97-D105 VanDerWaalsContact O-CA 3.24Å; R97-D105 WeakPolarHBondContact O-CA 3.43Å
106	F	94.9	Very high	94	Very high	13 Å²	13	66.8 Å²	66.8	6%	0.057	35%	0.346	C	S	.	.			trans	-73.2	136.6	168.2	-62.7	-65.9	0	0	0	110.3	Y85 I96 R97 E98 C99 D110 I112 I120 H122	Y85-F106 HydrophobicContact CD1-CB 3.53Å; Y85-F106 HydrophobicContact CD2-CB 3.77Å; Y85-F106 HydrophobicContact CD2-CD2 4.33Å; Y85-F106 HydrophobicContact CD2-CG 4.07Å; Y85-F106 HydrophobicContact CE1-CB 3.58Å; Y85-F106 HydrophobicContact CE2-CB 3.84Å; Y85-F106 HydrophobicContact CE2-CD2 4.15Å; Y85-F106 HydrophobicContact CE2-CG 4.22Å; Y85-F106 HydrophobicContact CG-CB 3.62Å; Y85-F106 HydrophobicContact CG-CG 4.27Å; I96-F106 HydrophobicContact CG2-CE2 4.32Å; R97-F106 VanDerWaalsContact C-CD2 3.45Å; R97-F106 WeakPolarHBondContact O-CD2 2.86Å; R97-F106 PolarHBondContact O-N 3.11Å; E98-F106 VanDerWaalsContact C-CE2 3.43Å; E98-F106 WeakPolarHBondContact O-CE2 3.48Å; C99-F106 HydrophobicContact CB-CE1 3.71Å; C99-F106 HydrophobicContact CB-CE2 4.49Å; C99-F106 HydrophobicContact CB-CZ 3.67Å; F106-D110 WeakPolarHBondContact CA-OD2 3.44Å; F106-I112 HydrophobicContact CD1-CG2 3.9Å; F106-I112 HydrophobicContact CE1-CG2 3.86Å; F106-I120 HydrophobicContact CD2-CD1 4.31Å; F106-I120 HydrophobicContact CE2-CD1 3.86Å; F106-I120 HydrophobicContact CE2-CG1 4.03Å; F106-I120 HydrophobicContact CZ-CD1 4.31Å; F106-I120 HydrophobicContact CZ-CG1 4.2Å; F106-H122 AromaticContact CD1-CD2 3.9Å; F106-H122 AromaticContact CD1-CE1 3.83Å; F106-H122 AromaticContact CD1-NE2 3.56Å; F106-H122 AromaticContact CE1-CE1 3.98Å; F106-H122 AromaticContact CE1-NE2 3.99Å
107	V	93.3	Very high	95.2	Very high	93 Å²	93	65.2 Å²	65.2	56%	0.564	34%	0.341	S	S	*	.			trans	-112.1	148.5	173.9	-174.7	0	0	0	0	109.6	Y85 G109 D110	Y85-V107 WeakPolarHBondContact CD1-O 3.38Å; V107-G109 PolarHBondContact O-N 3.32Å; V107-D110 PolarHBondContact N-OD2 2.91Å; V107-D110 VanDerWaalsContact O-CB 3.28Å; V107-D110 WeakPolarHBondContact O-CB 3.46Å; V107-D110 VanDerWaalsContact O-CG 3.26Å; V107-D110 PolarHBondContact O-N 3.29Å
108	Y	93.5	Very high	95.6	Very high	161 Å²	161	65.5 Å²	65.5	63%	0.631	35%	0.351	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.3	128.9	174.2	173.2	-90	0	0	0	110	Y85 D86	Y85-Y108 WeakPolarHBondContact O-CA 3.23Å; D86-Y108 HydrophobicContact CB-CD2 4.15Å; D86-Y108 HydrophobicContact CB-CE2 4.14Å
109	G	94.6	Very high	95.7	Very high	38 Å²	38	63.9 Å²	63.9	39%	0.392	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	98.6	-14.3	-176.9	0	0	0	0	0	114.4	Y85 V107	Y85-G109 PolarHBondContact O-N 3.49Å; V107-G109 PolarHBondContact O-N 3.32Å
110	D	96.4	Very high	95.6	Very high	37 Å²	37	65.1 Å²	65.1	20%	0.198	35%	0.349	C	S	.	.			trans	-60.9	133.6	-178.5	-80	-4.7	0	0	0	111.5	V84 Y85 F106 V107 I112 H122	V84-D110 CarbonylContact C-O 3.6Å; V84-D110 WeakPolarHBondContact CA-O 3.23Å; Y85-D110 PolarHBondContact N-O 2.94Å; F106-D110 WeakPolarHBondContact CA-OD2 3.44Å; V107-D110 PolarHBondContact N-OD2 2.91Å; V107-D110 VanDerWaalsContact O-CB 3.28Å; V107-D110 WeakPolarHBondContact O-CB 3.46Å; V107-D110 VanDerWaalsContact O-CG 3.26Å; V107-D110 PolarHBondContact O-N 3.29Å; D110-I112 PolarHBondContact O-N 3.09Å; D110-H122 IonicContact OD2-CD2 3.36Å; D110-H122 IonicContact OD2-CE1 2.65Å; D110-H122 IonicContact OD2-NE2 3.63Å; D110-H122 PolarHBondContact OD2-NE2 3.27Å
111	P	98	Very high	95.7	Very high	61 Å²	61	61.9 Å²	61.9	40%	0.396	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.9	121.8	172	29.4	-32.7	0	0	0	108.9	H122 L123	P111-H122 WeakPolarHBondContact O-CA 3.34Å; P111-L123 HydrophobicContact CB-CB 4.03Å; P111-L123 HydrophobicContact CB-CD1 4.47Å; P111-L123 PolarHBondContact O-N 2.88Å
112	I	97	Very high	95.8	Very high	5 Å²	5	60.7 Å²	60.7	3%	0.026	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	155	-179.6	58.6	170	0	0	0	111.2	K82 G83 Y85 F106 D110 F114 Y121	K82-I112 CarbonylContact C-O 3.58Å; K82-I112 WeakPolarHBondContact CA-O 3.36Å; G83-I112 PolarHBondContact N-O 3.39Å; G83-I112 PolarHBondContact O-N 3.45Å; Y85-I112 HydrophobicContact CD2-CD1 4.45Å; F106-I112 HydrophobicContact CD1-CG2 3.9Å; F106-I112 HydrophobicContact CE1-CG2 3.86Å; D110-I112 PolarHBondContact O-N 3.09Å; I112-F114 HydrophobicContact CD1-CE1 4.16Å; I112-F114 HydrophobicContact CD1-CE2 3.98Å; I112-F114 HydrophobicContact CD1-CZ 3.51Å; I112-F114 HydrophobicContact CG1-CE2 4.13Å; I112-F114 HydrophobicContact CG1-CZ 4.18Å; I112-Y121 VanDerWaalsContact CA-O 3.23Å; I112-Y121 WeakPolarHBondContact CA-O 3.28Å; I112-Y121 WeakPolarHBondContact CB-O 3.47Å
113	R	97.5	Very high	95.8	Very high	11 Å²	11	60.5 Å²	60.5	4%	0.042	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	139.2	171.8	-179.3	176.2	-58.4	-93.5	24	110.3	I77 L80 P81 I120 Y121 I126 D127	I77-R113 PolarHBondContact O-NH1 3.11Å; I77-R113 PolarHBondContact O-NH2 3.04Å; L80-R113 HydrophobicContact CB-CG 4.11Å; L80-R113 PolarHBondContact O-NH1 2.97Å; P81-R113 WeakPolarHBondContact O-CG 3.33Å; R113-I120 WeakPolarHBondContact O-CA 3.49Å; R113-Y121 PolarHBondContact N-O 3.13Å; R113-Y121 PolarHBondContact O-N 2.86Å; R113-I126 HydrophobicContact CB-CG2 3.71Å; R113-I126 HydrophobicContact CG-CG2 4.17Å; R113-D127 WeakPolarHBondContact CD-OD1 3.44Å; R113-D127 IonicContact CZ-OD1 3.99Å; R113-D127 IonicContact CZ-OD2 2.61Å; R113-D127 IonicContact NE-OD1 3.62Å; R113-D127 PolarHBondContact NE-OD1 3.18Å; R113-D127 IonicContact NE-OD2 2.87Å; R113-D127 VanDerWaalsContact NH2-CG 3.32Å; R113-D127 IonicContact NH2-OD1 3.09Å; R113-D127 PolarHBondContact NH2-OD1 3.5Å; R113-D127 VanDerWaalsContact NH2-OD1 3.09Å; R113-D127 IonicContact NH2-OD2 2.74Å; R113-D127 PolarHBondContact NH2-OD2 2.85Å
114	F	95.3	Very high	95.8	Very high	67 Å²	67	58.7 Å²	58.7	29%	0.294	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.6	127.4	175.9	-54.4	-96.8	0	0	0	108.5	P81 I112 I120	P81-F114 HydrophobicContact CB-CB 4.25Å; P81-F114 HydrophobicContact CB-CD2 4.39Å; P81-F114 PolarHBondContact O-N 3.29Å; I112-F114 HydrophobicContact CD1-CE1 4.16Å; I112-F114 HydrophobicContact CD1-CE2 3.98Å; I112-F114 HydrophobicContact CD1-CZ 3.51Å; I112-F114 HydrophobicContact CG1-CE2 4.13Å; I112-F114 HydrophobicContact CG1-CZ 4.18Å; F114-I120 HydrophobicContact CD1-CG2 3.38Å; F114-I120 HydrophobicContact CE1-CG2 3.62Å; F114-I120 HydrophobicContact CG-CG2 4.21Å
115	L	96.5	Very high	95.9	Very high	3 Å²	3	54.7 Å²	54.7	2%	0.016	30%	0.296	C	S	.	.			trans	-84.6	159.7	168.7	-59.5	-169.3	0	0	0	110.5	L80 C117 M118 H119 Y121 I126 L130 C136 V143	L80-L115 HydrophobicContact CD1-CD2 3.86Å; L115-C117 PolarHBondContact O-N 2.82Å; L115-C117 VanDerWaalsContact O-N 3.14Å; L115-M118 WeakPolarHBondContact O-CA 3.21Å; L115-M118 PolarHBondContact O-N 2.83Å; L115-H119 PolarHBondContact N-O 2.9Å; L115-Y121 HydrophobicContact CD1-CD2 4.25Å; L115-Y121 HydrophobicContact CD1-CE2 3.59Å; L115-Y121 HydrophobicContact CG-CD2 4.26Å; L115-Y121 HydrophobicContact CG-CE2 3.97Å; L115-I126 HydrophobicContact CD1-CD1 4.15Å; L115-I126 HydrophobicContact CD1-CG1 4.38Å; L115-I126 HydrophobicContact CD2-CG1 4.03Å; L115-I126 HydrophobicContact CG-CG1 4.49Å; L115-L130 HydrophobicContact CD2-CD1 4.07Å; L115-C136 HydrophobicContact CD1-CB 3.84Å; L115-V143 HydrophobicContact CD1-CG2 4.01Å; L115-V143 HydrophobicContact CD2-CG1 4.15Å
116	P	95.3	Very high	96	Very high	73 Å²	73	49.5 Å²	49.5	47%	0.474	27%	0.268	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.8	-28.4	177	-24.2	35.2	0	0	0	113.2	L80 M118 V143	L80-P116 HydrophobicContact CD2-CG 4.11Å; P116-M118 PolarHBondContact O-N 2.95Å; P116-V143 HydrophobicContact CG-CG1 4.47Å
117	C	95.4	Very high	96.1	Very high	48 Å²	48	50.4 Å²	50.4	32%	0.324	27%	0.273	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.4	10.5	174.1	63.5	0	0	0	0	114.3	L115 H119 C136	L115-C117 PolarHBondContact O-N 2.82Å; L115-C117 VanDerWaalsContact O-N 3.14Å; C117-H119 PolarHBondContact O-N 3.47Å; C117-H119 PolarHBondContact SG-ND1 2.99Å; C117-H119 VanDerWaalsContact SG-ND1 3.43Å; C117-C136 PolarHBondContact SG-SG 3.06Å
118	M	92	Very high	96.2	Very high	153 Å²	153	50.7 Å²	50.7	75%	0.754	27%	0.272	S	S	*	.	S	Bend	trans	68	5.7	177	-55.3	-67.2	153.9	0	0	116.2	L115 P116	L115-M118 WeakPolarHBondContact O-CA 3.21Å; L115-M118 PolarHBondContact O-N 2.83Å; P116-M118 PolarHBondContact O-N 2.95Å
119	H	94.8	Very high	96.3	Very high	48 Å²	48	47.6 Å²	47.6	22%	0.222	26%	0.259	C	S	.	.			trans	-74.6	145.9	169.5	-67.7	100.9	0	0	0	111.3	L115 C117 Y121 S138	L115-H119 PolarHBondContact N-O 2.9Å; C117-H119 PolarHBondContact O-N 3.47Å; C117-H119 PolarHBondContact SG-ND1 2.99Å; C117-H119 VanDerWaalsContact SG-ND1 3.43Å; H119-Y121 HydrophobicContact CB-CE2 3.72Å; H119-S138 WeakPolarHBondContact CD2-CB 3.41Å; H119-S138 WeakPolarHBondContact NE2-CB 3.38Å
120	I	95.2	Very high	96.4	Very high	26 Å²	26	45.8 Å²	45.8	13%	0.133	24%	0.24	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	146.1	-177.7	63.4	167	0	0	0	111.3	F106 R113 F114	F106-I120 HydrophobicContact CD2-CD1 4.31Å; F106-I120 HydrophobicContact CE2-CD1 3.86Å; F106-I120 HydrophobicContact CE2-CG1 4.03Å; F106-I120 HydrophobicContact CZ-CD1 4.31Å; F106-I120 HydrophobicContact CZ-CG1 4.2Å; R113-I120 WeakPolarHBondContact O-CA 3.49Å; F114-I120 HydrophobicContact CD1-CG2 3.38Å; F114-I120 HydrophobicContact CE1-CG2 3.62Å; F114-I120 HydrophobicContact CG-CG2 4.21Å
121	Y	97.8	Very high	96.1	Very high	1 Å²	1	46 Å²	46	0%	0.004	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-147.9	162.7	180	-53.6	-89.7	0	0	0	109.3	V100 I101 I112 R113 L115 H119 L123 I126 C136 P137 S138	V100-Y121 HydrophobicContact CG2-CD1 4.13Å; V100-Y121 HydrophobicContact CG2-CE1 3.52Å; I101-Y121 HydrophobicContact CD1-CD1 3.59Å; I101-Y121 HydrophobicContact CD1-CE1 4.22Å; I101-Y121 HydrophobicContact CD1-CG 4.08Å; I101-Y121 HydrophobicContact CG1-CD1 3.81Å; I101-Y121 HydrophobicContact CG1-CE1 4.22Å; I112-Y121 VanDerWaalsContact CA-O 3.23Å; I112-Y121 WeakPolarHBondContact CA-O 3.28Å; I112-Y121 WeakPolarHBondContact CB-O 3.47Å; R113-Y121 PolarHBondContact N-O 3.13Å; R113-Y121 PolarHBondContact O-N 2.86Å; L115-Y121 HydrophobicContact CD1-CD2 4.25Å; L115-Y121 HydrophobicContact CD1-CE2 3.59Å; L115-Y121 HydrophobicContact CG-CD2 4.26Å; L115-Y121 HydrophobicContact CG-CE2 3.97Å; H119-Y121 HydrophobicContact CB-CE2 3.72Å; Y121-L123 PolarHBondContact O-N 2.97Å; Y121-I126 HydrophobicContact CD2-CB 4.03Å; Y121-I126 HydrophobicContact CD2-CD1 3.81Å; Y121-I126 HydrophobicContact CD2-CG1 3.77Å; Y121-I126 HydrophobicContact CE2-CD1 4.03Å; Y121-I126 HydrophobicContact CE2-CG1 4.39Å; Y121-I126 HydrophobicContact CG-CB 3.92Å; Y121-I126 HydrophobicContact CG-CD1 4.11Å; Y121-I126 HydrophobicContact CG-CG1 4.13Å; Y121-C136 PolarHBondContact OH-SG 3.14Å; Y121-P137 HydrophobicContact CE1-CB 3.98Å; Y121-P137 HydrophobicContact CE1-CG 3.8Å; Y121-P137 WeakPolarHBondContact OH-CD 3.13Å; Y121-S138 VanDerWaalsContact OH-CB 3.22Å; Y121-S138 WeakPolarHBondContact OH-CB 3.42Å; Y121-S138 PolarHBondContact OH-N 2.88Å; Y121-S138 VanDerWaalsContact OH-N 3.15Å; Y121-S138 PolarHBondContact OH-OG 2.87Å
122	H	98.4	Very high	95.7	Very high	27 Å²	27	49.2 Å²	49.2	13%	0.125	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-58.7	137.4	164.6	-70.5	114	0	0	0	108.9	C99 C102 F106 D110 P111 D124 C125 I126	C99-H122 WeakPolarHBondContact CB-ND1 3.46Å; C102-H122 PolarHBondContact SG-ND1 3.42Å; C102-H122 VanDerWaalsContact SG-ND1 3.42Å; F106-H122 AromaticContact CD1-CD2 3.9Å; F106-H122 AromaticContact CD1-CE1 3.83Å; F106-H122 AromaticContact CD1-NE2 3.56Å; F106-H122 AromaticContact CE1-CE1 3.98Å; F106-H122 AromaticContact CE1-NE2 3.99Å; D110-H122 IonicContact OD2-CD2 3.36Å; D110-H122 IonicContact OD2-CE1 2.65Å; D110-H122 IonicContact OD2-NE2 3.63Å; D110-H122 PolarHBondContact OD2-NE2 3.27Å; P111-H122 WeakPolarHBondContact O-CA 3.34Å; H122-D124 VanDerWaalsContact C-N 3.32Å; H122-D124 PolarHBondContact O-N 3.22Å; H122-C125 HydrophobicContact CB-CB 3.97Å; H122-C125 WeakPolarHBondContact O-CB 3.22Å; H122-C125 PolarHBondContact O-N 3.3Å; H122-C125 VanDerWaalsContact O-N 3.11Å; H122-I126 WeakPolarHBondContact O-CG2 3.47Å; H122-I126 PolarHBondContact O-N 2.86Å; H122-I126 VanDerWaalsContact O-N 3.09Å
123	L	97.9	Very high	95.5	Very high	33 Å²	33	51.1 Å²	51.1	17%	0.173	26%	0.258	C	S	.	.	H	α-helix	trans	-52.7	-50.8	-175	-173.7	150.8	0	0	0	111.3	K82 P111 Y121 C125 I126 D127	K82-L123 HydrophobicContact CB-CD1 4.1Å; K82-L123 HydrophobicContact CD-CD1 4.24Å; P111-L123 HydrophobicContact CB-CB 4.03Å; P111-L123 HydrophobicContact CB-CD1 4.47Å; P111-L123 PolarHBondContact O-N 2.88Å; Y121-L123 PolarHBondContact O-N 2.97Å; L123-C125 VanDerWaalsContact C-N 3.35Å; L123-C125 PolarHBondContact O-N 2.89Å; L123-I126 PolarHBondContact O-N 3.13Å; L123-D127 WeakPolarHBondContact O-CB 3.24Å; L123-D127 PolarHBondContact O-N 2.72Å
124	D	97.6	Very high	95.2	Very high	110 Å²	110	52.8 Å²	52.8	59%	0.588	27%	0.266	S	S	*	.	H	α-helix	trans	-65.3	-39	-178.8	-57.3	-31.1	0	0	0	112	H122 I126 D128	H122-D124 VanDerWaalsContact C-N 3.32Å; H122-D124 PolarHBondContact O-N 3.22Å; D124-I126 PolarHBondContact O-N 2.96Å; D124-D128 PolarHBondContact O-N 3.48Å
125	C	98.1	Very high	95.3	Very high	31 Å²	31	51.5 Å²	51.5	21%	0.209	26%	0.264	C	S	.	.	H	α-helix	trans	-63.6	-45.5	-178.3	-70.9	0	0	0	0	112	I101 H122 L123 W129	I101-C125 HydrophobicContact CB-CB 4.01Å; I101-C125 HydrophobicContact CD1-CB 3.96Å; I101-C125 HydrophobicContact CG2-CB 3.92Å; H122-C125 HydrophobicContact CB-CB 3.97Å; H122-C125 WeakPolarHBondContact O-CB 3.22Å; H122-C125 PolarHBondContact O-N 3.3Å; H122-C125 VanDerWaalsContact O-N 3.11Å; L123-C125 VanDerWaalsContact C-N 3.35Å; L123-C125 PolarHBondContact O-N 2.89Å; C125-W129 WeakPolarHBondContact O-CB 3.24Å; C125-W129 PolarHBondContact O-N 3.06Å
126	I	97.6	Very high	95.3	Very high	0 Å²	0	51.4 Å²	51.4	0%	0	26%	0.263	C	S	.	.	H	α-helix	trans	-80.9	-29.1	-178	-170.4	62.2	0	0	0	112.6	I101 R113 L115 Y121 H122 L123 D124 W129 L130 P137	I101-I126 HydrophobicContact CD1-CB 4.1Å; I101-I126 HydrophobicContact CD1-CD1 3.99Å; R113-I126 HydrophobicContact CB-CG2 3.71Å; R113-I126 HydrophobicContact CG-CG2 4.17Å; L115-I126 HydrophobicContact CD1-CD1 4.15Å; L115-I126 HydrophobicContact CD1-CG1 4.38Å; L115-I126 HydrophobicContact CD2-CG1 4.03Å; L115-I126 HydrophobicContact CG-CG1 4.49Å; Y121-I126 HydrophobicContact CD2-CB 4.03Å; Y121-I126 HydrophobicContact CD2-CD1 3.81Å; Y121-I126 HydrophobicContact CD2-CG1 3.77Å; Y121-I126 HydrophobicContact CE2-CD1 4.03Å; Y121-I126 HydrophobicContact CE2-CG1 4.39Å; Y121-I126 HydrophobicContact CG-CB 3.92Å; Y121-I126 HydrophobicContact CG-CD1 4.11Å; Y121-I126 HydrophobicContact CG-CG1 4.13Å; H122-I126 WeakPolarHBondContact O-CG2 3.47Å; H122-I126 PolarHBondContact O-N 2.86Å; H122-I126 VanDerWaalsContact O-N 3.09Å; L123-I126 PolarHBondContact O-N 3.13Å; D124-I126 PolarHBondContact O-N 2.96Å; I126-W129 HydrophobicContact CD1-CB 4.24Å; I126-W129 HydrophobicContact CD1-CG 4.3Å; I126-W129 PolarHBondContact O-N 3.48Å; I126-L130 HydrophobicContact CD1-CD1 4.46Å; I126-L130 HydrophobicContact CD1-CD2 4.41Å; I126-L130 HydrophobicContact CD1-CG 4.08Å; I126-L130 HydrophobicContact CG1-CD1 3.94Å; I126-L130 HydrophobicContact CG1-CG 4.03Å; I126-L130 WeakPolarHBondContact O-CB 3.43Å; I126-L130 VanDerWaalsContact O-CG 3.23Å; I126-L130 WeakPolarHBondContact O-CG 3.45Å; I126-L130 PolarHBondContact O-N 3.2Å; I126-P137 HydrophobicContact CD1-CG 3.87Å
127	D	96.8	Very high	95.3	Very high	32 Å²	32	48.9 Å²	48.9	17%	0.171	25%	0.247	C	C	.	.	H	α-helix	trans	-64.4	-46.6	176	-75.7	9.9	0	0	0	110.9	I77 R113 L123 W129 L130 M131	I77-D127 HydrophobicContact CG2-CB 4.12Å; I77-D127 VanDerWaalsContact CG2-CG 3.48Å; I77-D127 WeakPolarHBondContact CG2-OD1 3.41Å; R113-D127 WeakPolarHBondContact CD-OD1 3.44Å; R113-D127 IonicContact CZ-OD1 3.99Å; R113-D127 IonicContact CZ-OD2 2.61Å; R113-D127 IonicContact NE-OD1 3.62Å; R113-D127 PolarHBondContact NE-OD1 3.18Å; R113-D127 IonicContact NE-OD2 2.87Å; R113-D127 VanDerWaalsContact NH2-CG 3.32Å; R113-D127 IonicContact NH2-OD1 3.09Å; R113-D127 PolarHBondContact NH2-OD1 3.5Å; R113-D127 VanDerWaalsContact NH2-OD1 3.09Å; R113-D127 IonicContact NH2-OD2 2.74Å; R113-D127 PolarHBondContact NH2-OD2 2.85Å; L123-D127 WeakPolarHBondContact O-CB 3.24Å; L123-D127 PolarHBondContact O-N 2.72Å; D127-W129 VanDerWaalsContact C-N 3.3Å; D127-W129 PolarHBondContact O-N 3.15Å; D127-L130 PolarHBondContact O-N 3.22Å; D127-M131 WeakPolarHBondContact O-CG 3.37Å; D127-M131 PolarHBondContact O-N 3.44Å; D127-M131 VanDerWaalsContact O-N 3.08Å
128	D	94.9	Very high	95.3	Very high	100 Å²	100	49.2 Å²	49.2	54%	0.535	25%	0.25	S	S	.	.	H	α-helix	trans	-61.8	-39	175	-81.3	-5.6	0	0	0	112.1	D124	D124-D128 PolarHBondContact O-N 3.48Å
129	W	95.4	Very high	95.5	Very high	96 Å²	96	43.9 Å²	43.9	36%	0.364	23%	0.227	S	C	.	.	H	α-helix	trans	-62.8	-50	175.1	178.4	-85.3	0	0	0	111.6	I101 C125 I126 D127 M131 R132 S133 T135 P137	I101-W129 HydrophobicContact CD1-CB 4.26Å; C125-W129 WeakPolarHBondContact O-CB 3.24Å; C125-W129 PolarHBondContact O-N 3.06Å; I126-W129 HydrophobicContact CD1-CB 4.24Å; I126-W129 HydrophobicContact CD1-CG 4.3Å; I126-W129 PolarHBondContact O-N 3.48Å; D127-W129 VanDerWaalsContact C-N 3.3Å; D127-W129 PolarHBondContact O-N 3.15Å; W129-M131 VanDerWaalsContact C-N 3.25Å; W129-M131 PolarHBondContact O-N 3.26Å; W129-R132 WeakPolarHBondContact O-CA 3.49Å; W129-R132 WeakPolarHBondContact O-CB 3.06Å; W129-R132 PolarHBondContact O-N 3.32Å; W129-S133 PolarHBondContact O-N 2.85Å; W129-T135 PolarHBondContact NE1-O 3.43Å; W129-P137 HydrophobicContact CD2-CG 3.98Å; W129-P137 HydrophobicContact CG-CG 4.09Å; W129-P137 HydrophobicContact CZ2-CB 4.37Å; W129-P137 HydrophobicContact CZ2-CG 4.24Å
130	L	95.8	Very high	95.6	Very high	0 Å²	0	48 Å²	48	0%	0	25%	0.248	C	C	.	.	H	α-helix	trans	-66.9	-25.8	-175.9	-70.1	176.6	0	0	0	113.2	I77 L80 L115 I126 D127 R132 S133 V143	I77-L130 HydrophobicContact CD1-CB 3.56Å; I77-L130 HydrophobicContact CG1-CB 3.75Å; I77-L130 HydrophobicContact CG1-CD1 4.03Å; L80-L130 HydrophobicContact CD1-CD1 3.55Å; L115-L130 HydrophobicContact CD2-CD1 4.07Å; I126-L130 HydrophobicContact CD1-CD1 4.46Å; I126-L130 HydrophobicContact CD1-CD2 4.41Å; I126-L130 HydrophobicContact CD1-CG 4.08Å; I126-L130 HydrophobicContact CG1-CD1 3.94Å; I126-L130 HydrophobicContact CG1-CG 4.03Å; I126-L130 WeakPolarHBondContact O-CB 3.43Å; I126-L130 VanDerWaalsContact O-CG 3.23Å; I126-L130 WeakPolarHBondContact O-CG 3.45Å; I126-L130 PolarHBondContact O-N 3.2Å; D127-L130 PolarHBondContact O-N 3.22Å; L130-R132 PolarHBondContact O-N 2.89Å; L130-S133 WeakPolarHBondContact CA-O 3.35Å; L130-V143 HydrophobicContact CD2-CB 4.17Å; L130-V143 HydrophobicContact CD2-CG1 4.48Å; L130-V143 HydrophobicContact CD2-CG2 3.82Å
131	M	92	Very high	95.7	Very high	42 Å²	42	52.5 Å²	52.5	21%	0.207	27%	0.269	C	S	.	.	H	α-helix	trans	-62.9	-31.3	170	-75.6	-58.8	-62.1	0	0	112.5	Y49 I70 R73 I74 I77 D127 W129	Y49-M131 HydrophobicContact CD1-CE 4.33Å; I70-M131 HydrophobicContact CG2-CE 4.23Å; R73-M131 PolarHBondContact NH1-O 3.03Å; I74-M131 HydrophobicContact CD1-CE 4.29Å; I74-M131 HydrophobicContact CG1-CE 3.95Å; I74-M131 HydrophobicContact CG1-SD 3.75Å; I77-M131 HydrophobicContact CD1-CG 4.02Å; I77-M131 HydrophobicContact CD1-SD 3.78Å; D127-M131 WeakPolarHBondContact O-CG 3.37Å; D127-M131 PolarHBondContact O-N 3.44Å; D127-M131 VanDerWaalsContact O-N 3.08Å; W129-M131 VanDerWaalsContact C-N 3.25Å; W129-M131 PolarHBondContact O-N 3.26Å
132	R	89.3	Confident	95.5	Very high	127 Å²	127	56.2 Å²	56.2	48%	0.479	29%	0.293	S	S	.	.	H	α-helix	trans	-91.9	-53.7	179.4	-63.6	174.4	-170.6	-155.3	1.4	111.9	H50 R73 W129 L130	H50-R132 PolarHBondContact CD2-NE 2.9Å; H50-R132 PolarHBondContact NE2-NE 3.4Å; H50-R132 VanDerWaalsContact NE2-NE 3.12Å; H50-R132 PolarHBondContact NE2-NH2 2.98Å; R73-R132 PolarHBondContact NH1-O 2.79Å; W129-R132 WeakPolarHBondContact O-CA 3.49Å; W129-R132 WeakPolarHBondContact O-CB 3.06Å; W129-R132 PolarHBondContact O-N 3.32Å; L130-R132 PolarHBondContact O-N 2.89Å
133	S	91.4	Very high	95.3	Very high	45 Å²	45	55 Å²	55	32%	0.315	29%	0.287	S	S	.	.			trans	-127.4	118.9	-176.9	-169.8	0	0	0	0	110.3	W129 L130 T135	W129-S133 PolarHBondContact O-N 2.85Å; L130-S133 WeakPolarHBondContact CA-O 3.35Å; S133-T135 PolarHBondContact O-N 3.06Å; S133-T135 PolarHBondContact OG-OG1 2.75Å
134	F	92.8	Very high	94.4	Very high	47 Å²	47	61.5 Å²	61.5	21%	0.206	32%	0.322	C	S	.	.			trans	-85.2	45.1	-176.6	-151.7	-121.1	0	0	0	112.6	R73 L76 V143	R73-F134 HydrophobicContact CB-CD2 4.43Å; R73-F134 HydrophobicContact CB-CE2 4.18Å; R73-F134 HydrophobicContact CG-CD2 3.78Å; R73-F134 HydrophobicContact CG-CE2 3.88Å; R73-F134 HydrophobicContact CG-CG 4.38Å; L76-F134 HydrophobicContact CB-CE2 4.21Å; L76-F134 HydrophobicContact CB-CZ 3.65Å; L76-F134 HydrophobicContact CD1-CE1 4.02Å; L76-F134 HydrophobicContact CD1-CZ 3.63Å; L76-F134 HydrophobicContact CD2-CE1 4.34Å; L76-F134 HydrophobicContact CD2-CE2 3.89Å; L76-F134 HydrophobicContact CD2-CZ 3.47Å; L76-F134 VanDerWaalsContact CD2-CZ 3.47Å; L76-F134 HydrophobicContact CG-CE2 4.45Å; L76-F134 HydrophobicContact CG-CZ 3.71Å; F134-V143 WeakPolarHBondContact CD1-O 3.33Å; F134-V143 WeakPolarHBondContact CE1-O 3.47Å; F134-V143 VanDerWaalsContact CZ-O 3.27Å; F134-V143 WeakPolarHBondContact CZ-O 3.38Å; F134-V143 PolarHBondContact O-N 3.42Å; F134-V143 VanDerWaalsContact O-N 3.13Å
135	T	95.8	Very high	94.3	Very high	39 Å²	39	59.1 Å²	59.1	24%	0.239	31%	0.309	C	S	.	.	B	Isolated β-bridge	trans	-136.8	146.3	-174.6	55.7	0	0	0	0	110.2	W129 S133 P137 E141	W129-T135 PolarHBondContact NE1-O 3.43Å; S133-T135 PolarHBondContact O-N 3.06Å; S133-T135 PolarHBondContact OG-OG1 2.75Å; T135-P137 WeakPolarHBondContact O-CD 3.3Å; T135-E141 CarbonylContact C-O 3.59Å; T135-E141 WeakPolarHBondContact CA-O 3.47Å
136	C	97	Very high	94.1	Very high	1 Å²	1	60.5 Å²	60.5	1%	0.007	31%	0.314	C	S	.	.			trans	-68.2	125.4	177.4	174.2	0	0	0	0	111	L115 C117 Y121 S138 C139 M140 E141 V143	L115-C136 HydrophobicContact CD1-CB 3.84Å; C117-C136 PolarHBondContact SG-SG 3.06Å; Y121-C136 PolarHBondContact OH-SG 3.14Å; C136-S138 PolarHBondContact O-N 2.61Å; C136-S138 PolarHBondContact SG-N 3.36Å; C136-S138 VanDerWaalsContact SG-N 3.44Å; C136-C139 VanDerWaalsContact CB-SG 3.52Å; C136-C139 PolarHBondContact SG-SG 2.65Å; C136-M140 VanDerWaalsContact O-CA 3.24Å; C136-M140 WeakPolarHBondContact O-CA 2.7Å; C136-M140 PolarHBondContact O-N 2.65Å; C136-E141 PolarHBondContact N-O 3.21Å; C136-V143 HydrophobicContact CB-CG2 4.37Å
137	P	96.6	Very high	93.9	Very high	21 Å²	21	63.9 Å²	63.9	14%	0.136	33%	0.332	C	S	.	.	T	Hydrogen-bonded Turn	trans	-58.7	-27.2	176.9	-22.9	28.8	0	0	0	114.8	V100 I101 Y121 I126 W129 T135 M140	V100-P137 HydrophobicContact CG2-CB 4.48Å; I101-P137 HydrophobicContact CD1-CG 4.08Å; I101-P137 HydrophobicContact CG1-CG 4.16Å; Y121-P137 HydrophobicContact CE1-CB 3.98Å; Y121-P137 HydrophobicContact CE1-CG 3.8Å; Y121-P137 WeakPolarHBondContact OH-CD 3.13Å; I126-P137 HydrophobicContact CD1-CG 3.87Å; W129-P137 HydrophobicContact CD2-CG 3.98Å; W129-P137 HydrophobicContact CG-CG 4.09Å; W129-P137 HydrophobicContact CZ2-CB 4.37Å; W129-P137 HydrophobicContact CZ2-CG 4.24Å; T135-P137 WeakPolarHBondContact O-CD 3.3Å; P137-M140 WeakPolarHBondContact O-CE 3.41Å
138	S	95.4	Very high	93.7	Very high	55 Å²	55	65.8 Å²	65.8	39%	0.385	34%	0.341	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.4	-36	-173.4	-63.1	0	0	0	0	113.8	H119 Y121 C136	H119-S138 WeakPolarHBondContact CD2-CB 3.41Å; H119-S138 WeakPolarHBondContact NE2-CB 3.38Å; Y121-S138 VanDerWaalsContact OH-CB 3.22Å; Y121-S138 WeakPolarHBondContact OH-CB 3.42Å; Y121-S138 PolarHBondContact OH-N 2.88Å; Y121-S138 VanDerWaalsContact OH-N 3.15Å; Y121-S138 PolarHBondContact OH-OG 2.87Å; C136-S138 PolarHBondContact O-N 2.61Å; C136-S138 PolarHBondContact SG-N 3.36Å; C136-S138 VanDerWaalsContact SG-N 3.44Å
139	C	96.1	Very high	93.6	Very high	41 Å²	41	63.6 Å²	63.6	28%	0.277	33%	0.329	S	S	.	.	T	Hydrogen-bonded Turn	trans	-116.3	-4.2	-178.4	67.9	0	0	0	0	114.5	C136 E141	C136-C139 VanDerWaalsContact CB-SG 3.52Å; C136-C139 PolarHBondContact SG-SG 2.65Å; C139-E141 HydrophobicContact CB-CG 4.45Å; C139-E141 PolarHBondContact O-N 2.96Å
140	M	95.7	Very high	93.5	Very high	134 Å²	134	61.5 Å²	61.5	66%	0.66	33%	0.327	S	S	*	.			trans	61.6	6.7	-179.5	-53.6	-64.1	174.4	0	0	115.3	C136 P137	C136-M140 VanDerWaalsContact O-CA 3.24Å; C136-M140 WeakPolarHBondContact O-CA 2.7Å; C136-M140 PolarHBondContact O-N 2.65Å; P137-M140 WeakPolarHBondContact O-CE 3.41Å
141	E	96.7	Very high	93.3	Very high	121 Å²	121	65.9 Å²	65.9	57%	0.565	35%	0.35	S	S	*	.			trans	-77.1	150	175.2	-64.5	-60.7	152.8	0	0	111.4	T135 C136 C139	T135-E141 CarbonylContact C-O 3.59Å; T135-E141 WeakPolarHBondContact CA-O 3.47Å; C136-E141 PolarHBondContact N-O 3.21Å; C139-E141 HydrophobicContact CB-CG 4.45Å; C139-E141 PolarHBondContact O-N 2.96Å
142	P	94.8	Very high	93.4	Very high	78 Å²	78	67.7 Å²	67.7	51%	0.506	36%	0.361	S	S	.	.	B	Isolated β-bridge	trans	-55.6	150.7	171.3	-22.7	33.7	0	0	0	112.5
143	V	93.4	Very high	93.8	Very high	1 Å²	1	62.8 Å²	62.8	1%	0.006	35%	0.351	C	S	.	.			trans	-106.1	70.8	172.4	-174.7	0	0	0	0	107.5	L76 L80 L115 P116 L130 F134 C136	L76-V143 HydrophobicContact CD2-CG1 4Å; L76-V143 WeakPolarHBondContact CD2-O 3.4Å; L80-V143 HydrophobicContact CD1-CG1 3.98Å; L80-V143 HydrophobicContact CD2-CG1 4Å; L115-V143 HydrophobicContact CD1-CG2 4.01Å; L115-V143 HydrophobicContact CD2-CG1 4.15Å; P116-V143 HydrophobicContact CG-CG1 4.47Å; L130-V143 HydrophobicContact CD2-CB 4.17Å; L130-V143 HydrophobicContact CD2-CG1 4.48Å; L130-V143 HydrophobicContact CD2-CG2 3.82Å; F134-V143 WeakPolarHBondContact CD1-O 3.33Å; F134-V143 WeakPolarHBondContact CE1-O 3.47Å; F134-V143 VanDerWaalsContact CZ-O 3.27Å; F134-V143 WeakPolarHBondContact CZ-O 3.38Å; F134-V143 PolarHBondContact O-N 3.42Å; F134-V143 VanDerWaalsContact O-N 3.13Å; C136-V143 HydrophobicContact CB-CG2 4.37Å
144	D	79.8	Confident	94	Very high	170 Å²	170	64.4 Å²	64.4	91%	0.909	35%	0.354	S	S	*	.			trans	-103.4	0	177.6	66.7	-15.2	0	0	0	113.8

Retrieved 144 of 144 residues in 28.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).