Z4YLX5_MOUSE Loading...

DnaJ heat shock protein family (Hsp40) member C25

AlphaFold DB , UniProt , Accession Z4YLX5, Species MOUSE (Mus musculus, Mouse), Gene Dnajc25, Length 79 aa.

						>Z4YLX5_MOUSE|Z4YLX5|Dnajc25
MLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	60.2	Low	231 Å²	231	135.8 Å²	135.8	100%	1.138	66%	0.659	S	S	*	*				0	146.1	0	-80.3	162.7	120	0	0	106.5	D3	M1-D3 PolarHBondContact O-N 3.19Å; M1-D3 VanDerWaalsContact O-N 3.14Å
2	L	60.8	Low	60.3	Low	151 Å²	151	137.2 Å²	137.2	79%	0.791	65%	0.653	S	S	*	*			trans	-63.1	110.3	-170	-75.3	115.2	0	0	0	111.4
3	D	62.6	Low	60.2	Low	136 Å²	136	139.7 Å²	139.7	73%	0.727	65%	0.654	S	S	*	*	S	Bend	trans	-86	-3.8	-178	-73.9	-35.1	0	0	0	113.8	M1	M1-D3 PolarHBondContact O-N 3.19Å; M1-D3 VanDerWaalsContact O-N 3.14Å
4	H	61.4	Low	60.4	Low	101 Å²	101	137.7 Å²	137.7	47%	0.468	65%	0.645	S	S	.	*			trans	-135.3	79.2	-174.8	-57.3	-32.4	0	0	0	112.4	E6 E7	H4-E6 PolarHBondContact O-N 3.17Å; H4-E7 HydrophobicContact CB-CB 3.99Å; H4-E7 HydrophobicContact CB-CG 3.87Å; H4-E7 IonicContact CD2-OE1 3.94Å; H4-E7 IonicContact CD2-OE2 3.56Å; H4-E7 IonicContact CG-OE2 3.97Å; H4-E7 PolarHBondContact O-N 3.16Å
5	P	60.6	Low	60.5	Low	85 Å²	85	136.7 Å²	136.7	55%	0.552	63%	0.634	S	S	*	*	H	α-helix	trans	-64	-24.8	176.9	25.9	-33.9	0	0	0	113.3
6	E	62.3	Low	60.3	Low	133 Å²	133	137 Å²	137	62%	0.621	63%	0.629	S	S	*	*	H	α-helix	trans	-70.6	-33.6	175	25.3	-82.8	142.4	0	0	113.4	H4 Y8 Y9 S10	H4-E6 PolarHBondContact O-N 3.17Å; E6-Y8 VanDerWaalsContact C-N 3.35Å; E6-Y9 PolarHBondContact O-N 3.29Å; E6-S10 PolarHBondContact O-N 3.36Å; E6-S10 VanDerWaalsContact O-N 3.1Å; E6-S10 PolarHBondContact O-OG 2.86Å; E6-S10 VanDerWaalsContact O-OG 3.08Å
7	E	60.2	Low	60.4	Low	117 Å²	117	132.6 Å²	132.6	55%	0.547	62%	0.618	S	S	.	*	H	α-helix	trans	-70.4	-34.7	179.1	-71.9	-174.5	171.8	0	0	111.4	H4 Y9 S10 H11	H4-E7 HydrophobicContact CB-CB 3.99Å; H4-E7 HydrophobicContact CB-CG 3.87Å; H4-E7 IonicContact CD2-OE1 3.94Å; H4-E7 IonicContact CD2-OE2 3.56Å; H4-E7 IonicContact CG-OE2 3.97Å; H4-E7 PolarHBondContact O-N 3.16Å; E7-Y9 VanDerWaalsContact C-N 3.31Å; E7-Y9 PolarHBondContact O-N 3.09Å; E7-S10 WeakPolarHBondContact CA-OG 3.24Å; E7-S10 PolarHBondContact O-N 3.31Å; E7-S10 PolarHBondContact O-OG 3.28Å; E7-S10 VanDerWaalsContact O-OG 3.09Å; E7-H11 WeakPolarHBondContact O-CB 3.31Å; E7-H11 PolarHBondContact O-N 3.41Å
8	Y	60.3	Low	60.4	Low	170 Å²	170	136.6 Å²	136.6	67%	0.667	63%	0.626	S	S	*	*	H	α-helix	trans	-61	-40.3	175.9	-169.1	-99.9	0	0	0	112.2	E6 Y12	E6-Y8 VanDerWaalsContact C-N 3.35Å; Y8-Y12 PolarHBondContact O-N 3.38Å
9	Y	58.3	Low	60.3	Low	163 Å²	163	139.2 Å²	139.2	64%	0.639	63%	0.63	S	S	*	*	H	α-helix	trans	-75.6	-40.8	179.5	-108.6	-86.9	0	0	0	113.3	E6 E7 Y12 Y13	E6-Y9 PolarHBondContact O-N 3.29Å; E7-Y9 VanDerWaalsContact C-N 3.31Å; E7-Y9 PolarHBondContact O-N 3.09Å; Y9-Y12 PolarHBondContact O-N 3.1Å; Y9-Y13 PolarHBondContact O-N 3.43Å
10	S	62.4	Low	60	Low	58 Å²	58	137.1 Å²	137.1	41%	0.406	62%	0.624	S	S	.	*	H	α-helix	trans	-68.2	-37.2	-179.7	56.8	0	0	0	0	112.2	E6 E7 Y12 Y13 H14	E6-S10 PolarHBondContact O-N 3.36Å; E6-S10 VanDerWaalsContact O-N 3.1Å; E6-S10 PolarHBondContact O-OG 2.86Å; E6-S10 VanDerWaalsContact O-OG 3.08Å; E7-S10 WeakPolarHBondContact CA-OG 3.24Å; E7-S10 PolarHBondContact O-N 3.31Å; E7-S10 PolarHBondContact O-OG 3.28Å; E7-S10 VanDerWaalsContact O-OG 3.09Å; S10-Y12 VanDerWaalsContact C-N 3.35Å; S10-Y12 PolarHBondContact O-N 3.27Å; S10-Y13 PolarHBondContact O-N 2.97Å; S10-H14 WeakPolarHBondContact O-CB 3.27Å; S10-H14 PolarHBondContact O-N 2.91Å
11	H	63.8	Low	60	Low	149 Å²	149	133.3 Å²	133.3	69%	0.69	62%	0.617	S	S	*	*	H	α-helix	trans	-66.6	-36.5	176.2	-128.1	-101.8	0	0	0	112.4	E7 H14 Y15	E7-H11 WeakPolarHBondContact O-CB 3.31Å; E7-H11 PolarHBondContact O-N 3.41Å; H11-H14 PolarHBondContact O-N 2.86Å; H11-Y15 WeakPolarHBondContact O-CB 3.35Å; H11-Y15 PolarHBondContact O-N 3.11Å
12	Y	61.6	Low	60.7	Low	152 Å²	152	126.8 Å²	126.8	60%	0.596	59%	0.592	S	S	*	*	H	α-helix	trans	-64.6	-45.3	177.5	-167.2	-110.5	0	0	0	111.9	Y8 Y9 S10 Y15 Y16	Y8-Y12 PolarHBondContact O-N 3.38Å; Y9-Y12 PolarHBondContact O-N 3.1Å; S10-Y12 VanDerWaalsContact C-N 3.35Å; S10-Y12 PolarHBondContact O-N 3.27Å; Y12-Y15 PolarHBondContact O-N 2.94Å; Y12-Y16 PolarHBondContact O-N 3.21Å
13	Y	59.3	Low	61.2	Low	170 Å²	170	130.1 Å²	130.1	67%	0.667	60%	0.6	S	S	*	*	H	α-helix	trans	-65.2	-40.1	175.3	-103.1	-85.3	0	0	0	112.8	Y9 S10 S17	Y9-Y13 PolarHBondContact O-N 3.43Å; S10-Y13 PolarHBondContact O-N 2.97Å; Y13-S17 WeakPolarHBondContact O-CB 3.5Å; Y13-S17 PolarHBondContact O-N 3.44Å; Y13-S17 PolarHBondContact O-OG 2.61Å; Y13-S17 VanDerWaalsContact O-OG 3.11Å
14	H	62.4	Low	61.7	Low	112 Å²	112	127.7 Å²	127.7	52%	0.519	59%	0.59	S	S	.	*	H	α-helix	trans	-69.4	-34.9	178	-95.8	-47.1	0	0	0	113.5	S10 H11 S17 R18	S10-H14 WeakPolarHBondContact O-CB 3.27Å; S10-H14 PolarHBondContact O-N 2.91Å; H11-H14 PolarHBondContact O-N 2.86Å; H14-S17 PolarHBondContact O-OG 3.35Å; H14-R18 PolarHBondContact O-N 2.88Å
15	Y	62.2	Low	62.8	Low	123 Å²	123	127 Å²	127	48%	0.482	59%	0.59	S	S	.	*	H	α-helix	trans	-67.6	-41.3	177.1	-173.8	-100.7	0	0	0	112	H11 Y12 R19	H11-Y15 WeakPolarHBondContact O-CB 3.35Å; H11-Y15 PolarHBondContact O-N 3.11Å; Y12-Y15 PolarHBondContact O-N 2.94Å; Y15-R19 PolarHBondContact O-N 3.26Å; Y15-R19 PolarHBondContact OH-NE 3.49Å; Y15-R19 PolarHBondContact OH-NH1 3.25Å
16	Y	57.5	Low	63.9	Low	141 Å²	141	127.1 Å²	127.1	55%	0.553	59%	0.589	S	S	*	*	H	α-helix	trans	-71.7	-43.7	178.5	-124.1	-119.9	0	0	0	111.8	Y12 R18 R19 L20	Y12-Y16 PolarHBondContact O-N 3.21Å; Y16-R18 VanDerWaalsContact C-N 3.33Å; Y16-R18 PolarHBondContact O-N 3.48Å; Y16-R19 PolarHBondContact O-N 2.87Å; Y16-L20 HydrophobicContact CD1-CD1 2.97Å; Y16-L20 HydrophobicContact CD1-CG 4.42Å; Y16-L20 HydrophobicContact CD2-CD1 3.75Å; Y16-L20 HydrophobicContact CE1-CD1 2.93Å; Y16-L20 HydrophobicContact CE1-CG 4.39Å; Y16-L20 HydrophobicContact CE2-CD1 3.7Å; Y16-L20 HydrophobicContact CG-CD1 3.37Å; Y16-L20 VanDerWaalsContact O-CB 3.31Å; Y16-L20 WeakPolarHBondContact O-CB 3.37Å; Y16-L20 PolarHBondContact O-N 2.93Å
17	S	61.5	Low	65.1	Low	63 Å²	63	129.7 Å²	129.7	44%	0.441	59%	0.593	S	S	.	*	H	α-helix	trans	-62.9	-35	179.6	63	0	0	0	0	113.7	Y13 H14 A21	Y13-S17 WeakPolarHBondContact O-CB 3.5Å; Y13-S17 PolarHBondContact O-N 3.44Å; Y13-S17 PolarHBondContact O-OG 2.61Å; Y13-S17 VanDerWaalsContact O-OG 3.11Å; H14-S17 PolarHBondContact O-OG 3.35Å; S17-A21 VanDerWaalsContact O-CB 3.3Å; S17-A21 WeakPolarHBondContact O-CB 3.42Å; S17-A21 PolarHBondContact O-N 3.5Å
18	R	60.3	Low	66.5	Low	204 Å²	204	127.6 Å²	127.6	77%	0.77	59%	0.588	S	S	*	*	H	α-helix	trans	-79.1	-27.8	179.4	-73.9	-177.7	178.4	177.4	1.2	114	H14 Y16	H14-R18 PolarHBondContact O-N 2.88Å; Y16-R18 VanDerWaalsContact C-N 3.33Å; Y16-R18 PolarHBondContact O-N 3.48Å
19	R	58.1	Low	67.9	Low	186 Å²	186	123 Å²	123	70%	0.702	58%	0.577	S	S	*	*	H	α-helix	trans	-93.9	-26.2	179.8	-71.8	-166.1	174.6	-149.5	2.6	114	Y15 Y16	Y15-R19 PolarHBondContact O-N 3.26Å; Y15-R19 PolarHBondContact OH-NE 3.49Å; Y15-R19 PolarHBondContact OH-NH1 3.25Å; Y16-R19 PolarHBondContact O-N 2.87Å
20	L	55.6	Low	69.6	Low	97 Å²	97	120.1 Å²	120.1	51%	0.508	57%	0.572	S	S	.	*	H	α-helix	trans	-107.6	4	-179.2	-68.5	150	0	0	0	113.8	Y16 P22	Y16-L20 HydrophobicContact CD1-CD1 2.97Å; Y16-L20 HydrophobicContact CD1-CG 4.42Å; Y16-L20 HydrophobicContact CD2-CD1 3.75Å; Y16-L20 HydrophobicContact CE1-CD1 2.93Å; Y16-L20 HydrophobicContact CE1-CG 4.39Å; Y16-L20 HydrophobicContact CE2-CD1 3.7Å; Y16-L20 HydrophobicContact CG-CD1 3.37Å; Y16-L20 VanDerWaalsContact O-CB 3.31Å; Y16-L20 WeakPolarHBondContact O-CB 3.37Å; Y16-L20 PolarHBondContact O-N 2.93Å; L20-P22 WeakPolarHBondContact O-CD 3.44Å
21	A	58.8	Low	71.1	Confident	58 Å²	58	122.9 Å²	122.9	48%	0.479	58%	0.581	S	S	.	*	S	Bend	trans	-52.5	108.9	161.3	0	0	0	0	0	107.2	S17 K23	S17-A21 VanDerWaalsContact O-CB 3.3Å; S17-A21 WeakPolarHBondContact O-CB 3.42Å; S17-A21 PolarHBondContact O-N 3.5Å; A21-K23 PolarHBondContact O-N 3.04Å
22	P	64.8	Low	72.6	Confident	94 Å²	94	120.1 Å²	120.1	61%	0.61	58%	0.575	S	S	*	*			trans	-59.2	120	-179.1	-17.8	30.8	0	0	0	106.7	L20 V24	L20-P22 WeakPolarHBondContact O-CD 3.44Å; P22-V24 WeakPolarHBondContact CB-O 3.25Å; P22-V24 PolarHBondContact O-N 3.41Å
23	K	70.5	Confident	74.2	Confident	221 Å²	221	115.7 Å²	115.7	96%	0.961	57%	0.566	S	S	*	*	S	Bend	trans	-61.2	-14.6	176.5	-70.6	-178.7	178.5	176.2	0	112.2	A21	A21-K23 PolarHBondContact O-N 3.04Å
24	V	73	Confident	76	Confident	85 Å²	85	112 Å²	112	52%	0.515	56%	0.561	S	S	.	*	S	Bend	trans	-111.2	123	178.5	-164.1	0	0	0	0	108	P22 V26 V28 V29	P22-V24 WeakPolarHBondContact CB-O 3.25Å; P22-V24 PolarHBondContact O-N 3.41Å; V24-V26 PolarHBondContact O-N 3.45Å; V24-V28 HydrophobicContact CG1-CB 4.45Å; V24-V28 HydrophobicContact CG1-CG1 4.48Å; V24-V29 HydrophobicContact CG1-CG2 4.14Å
25	D	85.3	Confident	77.6	Confident	86 Å²	86	110 Å²	110	46%	0.46	56%	0.559	S	S	.	*			trans	-58.4	129.7	175.9	-173.8	-19.8	0	0	0	109.7	R27 V28 V29	D25-R27 PolarHBondContact O-N 3.35Å; D25-R27 VanDerWaalsContact O-N 3.1Å; D25-R27 WeakPolarHBondContact OD1-CB 3.5Å; D25-R27 WeakPolarHBondContact OD1-CG 3.5Å; D25-R27 PolarHBondContact OD1-N 3.18Å; D25-V28 HydrophobicContact CB-CG2 4.23Å; D25-V28 WeakPolarHBondContact O-CB 3.39Å; D25-V28 PolarHBondContact O-N 2.9Å; D25-V29 PolarHBondContact O-N 3.48Å
26	V	83.8	Confident	79.2	Confident	88 Å²	88	106.5 Å²	106.5	53%	0.533	56%	0.555	S	S	.	*	H	α-helix	trans	-53.8	-31.9	178.9	-177.6	0	0	0	0	111.2	V24 V28 V29 I30	V24-V26 PolarHBondContact O-N 3.45Å; V26-V28 VanDerWaalsContact C-N 3.32Å; V26-V28 PolarHBondContact O-N 2.86Å; V26-V29 WeakPolarHBondContact O-CB 3.28Å; V26-V29 PolarHBondContact O-N 2.87Å; V26-I30 HydrophobicContact CG1-CD1 4.11Å; V26-I30 HydrophobicContact CG1-CG1 4.49Å; V26-I30 WeakPolarHBondContact O-CG1 3.29Å; V26-I30 PolarHBondContact O-N 3.23Å
27	R	86.4	Confident	81.1	Confident	187 Å²	187	104.4 Å²	104.4	71%	0.706	55%	0.553	S	S	*	*	H	α-helix	trans	-60.9	-40.3	176.4	-64.2	171.3	179	178.5	-0.2	112.5	D25 V29 I30 L31	D25-R27 PolarHBondContact O-N 3.35Å; D25-R27 VanDerWaalsContact O-N 3.1Å; D25-R27 WeakPolarHBondContact OD1-CB 3.5Å; D25-R27 WeakPolarHBondContact OD1-CG 3.5Å; D25-R27 PolarHBondContact OD1-N 3.18Å; R27-V29 VanDerWaalsContact C-N 3.35Å; R27-I30 PolarHBondContact O-N 2.9Å; R27-L31 PolarHBondContact O-N 3.34Å
28	V	89.9	Confident	82.7	Confident	73 Å²	73	104.8 Å²	104.8	44%	0.442	56%	0.555	S	S	.	*	H	α-helix	trans	-66.9	-41.2	177.6	176.9	0	0	0	0	110	V24 D25 V26 I30 L31 V32	V24-V28 HydrophobicContact CG1-CB 4.45Å; V24-V28 HydrophobicContact CG1-CG1 4.48Å; D25-V28 HydrophobicContact CB-CG2 4.23Å; D25-V28 WeakPolarHBondContact O-CB 3.39Å; D25-V28 PolarHBondContact O-N 2.9Å; V26-V28 VanDerWaalsContact C-N 3.32Å; V26-V28 PolarHBondContact O-N 2.86Å; V28-I30 VanDerWaalsContact C-N 3.33Å; V28-I30 PolarHBondContact O-N 3.43Å; V28-L31 PolarHBondContact O-N 3.29Å; V28-V32 HydrophobicContact CG1-CG2 4.26Å; V28-V32 WeakPolarHBondContact O-CB 3.32Å; V28-V32 VanDerWaalsContact O-CG2 3.31Å; V28-V32 WeakPolarHBondContact O-CG2 3.26Å; V28-V32 PolarHBondContact O-N 3.32Å
29	V	90.8	Very high	84.3	Confident	74 Å²	74	100.4 Å²	100.4	45%	0.448	55%	0.545	S	S	.	.	H	α-helix	trans	-61	-44	177.5	-177.5	0	0	0	0	111	V24 D25 V26 R27 S33	V24-V29 HydrophobicContact CG1-CG2 4.14Å; D25-V29 PolarHBondContact O-N 3.48Å; V26-V29 WeakPolarHBondContact O-CB 3.28Å; V26-V29 PolarHBondContact O-N 2.87Å; R27-V29 VanDerWaalsContact C-N 3.35Å; V29-S33 VanDerWaalsContact O-CB 3.31Å; V29-S33 WeakPolarHBondContact O-CB 3.47Å; V29-S33 PolarHBondContact O-N 3.44Å; V29-S33 PolarHBondContact O-OG 2.93Å
30	I	93	Very high	86	Confident	102 Å²	102	99 Å²	99	52%	0.523	54%	0.544	S	S	.	.	H	α-helix	trans	-63	-47.9	177	-66.5	168.2	0	0	0	110.5	V26 R27 V28 V32 S33 V34	V26-I30 HydrophobicContact CG1-CD1 4.11Å; V26-I30 HydrophobicContact CG1-CG1 4.49Å; V26-I30 WeakPolarHBondContact O-CG1 3.29Å; V26-I30 PolarHBondContact O-N 3.23Å; R27-I30 PolarHBondContact O-N 2.9Å; V28-I30 VanDerWaalsContact C-N 3.33Å; V28-I30 PolarHBondContact O-N 3.43Å; I30-V32 PolarHBondContact O-N 3Å; I30-S33 PolarHBondContact O-N 3.01Å; I30-V34 HydrophobicContact CG2-CG2 4.36Å; I30-V34 WeakPolarHBondContact O-CG2 3.4Å; I30-V34 PolarHBondContact O-N 3.19Å
31	L	95.1	Very high	87.6	Confident	115 Å²	115	100.3 Å²	100.3	60%	0.602	55%	0.548	S	S	*	.	H	α-helix	trans	-57.7	-49.7	178.4	-85.9	170.8	0	0	0	111.9	R27 V28 S33 V34 C35	R27-L31 PolarHBondContact O-N 3.34Å; V28-L31 PolarHBondContact O-N 3.29Å; L31-S33 VanDerWaalsContact C-N 3.31Å; L31-S33 PolarHBondContact O-N 3.27Å; L31-V34 PolarHBondContact O-N 3.44Å; L31-C35 WeakPolarHBondContact O-CB 3.3Å; L31-C35 PolarHBondContact O-N 2.9Å; L31-C35 PolarHBondContact O-SG 2.9Å
32	V	95.3	Very high	89.2	Confident	92 Å²	92	103.6 Å²	103.6	56%	0.558	55%	0.549	S	S	*	.	H	α-helix	trans	-61.7	-41.6	179.1	172.2	0	0	0	0	110.9	V28 I30 C35 A36	V28-V32 HydrophobicContact CG1-CG2 4.26Å; V28-V32 WeakPolarHBondContact O-CB 3.32Å; V28-V32 VanDerWaalsContact O-CG2 3.31Å; V28-V32 WeakPolarHBondContact O-CG2 3.26Å; V28-V32 PolarHBondContact O-N 3.32Å; I30-V32 PolarHBondContact O-N 3Å; V32-C35 PolarHBondContact O-N 3.24Å; V32-A36 VanDerWaalsContact O-CB 3.3Å; V32-A36 WeakPolarHBondContact O-CB 3.37Å; V32-A36 PolarHBondContact O-N 3.38Å
33	S	95.4	Very high	90.4	Very high	58 Å²	58	105.8 Å²	105.8	41%	0.406	55%	0.549	S	S	.	.	H	α-helix	trans	-63.1	-47	179.1	-58.1	0	0	0	0	111.6	V29 I30 L31 A36 I37	V29-S33 VanDerWaalsContact O-CB 3.31Å; V29-S33 WeakPolarHBondContact O-CB 3.47Å; V29-S33 PolarHBondContact O-N 3.44Å; V29-S33 PolarHBondContact O-OG 2.93Å; I30-S33 PolarHBondContact O-N 3.01Å; L31-S33 VanDerWaalsContact C-N 3.31Å; L31-S33 PolarHBondContact O-N 3.27Å; S33-A36 PolarHBondContact O-N 3.38Å; S33-I37 VanDerWaalsContact O-CG1 3.28Å; S33-I37 WeakPolarHBondContact O-CG1 3.41Å; S33-I37 PolarHBondContact O-N 3.41Å
34	V	96.6	Very high	91.1	Very high	92 Å²	92	98.3 Å²	98.3	56%	0.558	52%	0.524	S	S	*	.	H	α-helix	trans	-63.9	-43.9	178	173.4	0	0	0	0	110.9	I30 L31 A36 I37 S38	I30-V34 HydrophobicContact CG2-CG2 4.36Å; I30-V34 WeakPolarHBondContact O-CG2 3.4Å; I30-V34 PolarHBondContact O-N 3.19Å; L31-V34 PolarHBondContact O-N 3.44Å; V34-A36 PolarHBondContact O-N 2.83Å; V34-I37 PolarHBondContact O-N 3.02Å; V34-S38 VanDerWaalsContact O-CB 3.31Å; V34-S38 WeakPolarHBondContact O-CB 3.44Å; V34-S38 PolarHBondContact O-N 3.36Å
35	C	96.1	Very high	91.6	Very high	71 Å²	71	102.7 Å²	102.7	48%	0.48	53%	0.532	S	S	.	.	H	α-helix	trans	-60.5	-44.6	175.7	-73.6	0	0	0	0	112.1	L31 V32 S38 M39	L31-C35 WeakPolarHBondContact O-CB 3.3Å; L31-C35 PolarHBondContact O-N 2.9Å; L31-C35 PolarHBondContact O-SG 2.9Å; V32-C35 PolarHBondContact O-N 3.24Å; C35-S38 PolarHBondContact O-N 3.3Å; C35-M39 WeakPolarHBondContact O-CG 3.41Å; C35-M39 PolarHBondContact O-N 3.46Å
36	A	95.8	Very high	91.6	Very high	49 Å²	49	105 Å²	105	41%	0.405	53%	0.534	S	S	.	.	H	α-helix	trans	-62.6	-45.9	178.9	0	0	0	0	0	112	V32 S33 V34 M39 F40	V32-A36 VanDerWaalsContact O-CB 3.3Å; V32-A36 WeakPolarHBondContact O-CB 3.37Å; V32-A36 PolarHBondContact O-N 3.38Å; S33-A36 PolarHBondContact O-N 3.38Å; V34-A36 PolarHBondContact O-N 2.83Å; A36-M39 PolarHBondContact O-N 3Å; A36-F40 PolarHBondContact O-N 2.95Å
37	I	96.2	Very high	91.3	Very high	97 Å²	97	104.8 Å²	104.8	50%	0.497	53%	0.53	S	S	.	.	H	α-helix	trans	-62.2	-45	176.9	-67.9	166.6	0	0	0	110.4	S33 V34 M39 F40 Q41	S33-I37 VanDerWaalsContact O-CG1 3.28Å; S33-I37 WeakPolarHBondContact O-CG1 3.41Å; S33-I37 PolarHBondContact O-N 3.41Å; V34-I37 PolarHBondContact O-N 3.02Å; I37-M39 PolarHBondContact O-N 3.48Å; I37-F40 PolarHBondContact O-N 3.39Å; I37-Q41 HydrophobicContact CG2-CG 4.36Å; I37-Q41 VanDerWaalsContact O-CG 3.31Å; I37-Q41 WeakPolarHBondContact O-CG 3.31Å; I37-Q41 PolarHBondContact O-N 3.37Å
38	S	94.8	Very high	91.1	Very high	71 Å²	71	99 Å²	99	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-61.2	-45.3	179.5	-179.4	0	0	0	0	112.2	V34 C35 F40 Q41 Y42	V34-S38 VanDerWaalsContact O-CB 3.31Å; V34-S38 WeakPolarHBondContact O-CB 3.44Å; V34-S38 PolarHBondContact O-N 3.36Å; C35-S38 PolarHBondContact O-N 3.3Å; S38-F40 PolarHBondContact O-N 3.31Å; S38-Q41 PolarHBondContact O-N 2.97Å; S38-Y42 PolarHBondContact O-N 3.48Å
39	M	95.1	Very high	90.6	Very high	112 Å²	112	101.5 Å²	101.5	55%	0.552	52%	0.52	S	S	*	.	H	α-helix	trans	-59.7	-46.7	175.2	-75.1	-174	-70.3	0	0	111.4	C35 A36 I37 Q41 Y42 F43	C35-M39 WeakPolarHBondContact O-CG 3.41Å; C35-M39 PolarHBondContact O-N 3.46Å; A36-M39 PolarHBondContact O-N 3Å; I37-M39 PolarHBondContact O-N 3.48Å; M39-Q41 VanDerWaalsContact C-N 3.33Å; M39-Q41 PolarHBondContact O-N 3.42Å; M39-Y42 PolarHBondContact O-N 3.19Å; M39-F43 WeakPolarHBondContact O-CD2 3.37Å; M39-F43 PolarHBondContact O-N 3.17Å
40	F	93.2	Very high	90.1	Very high	158 Å²	158	101.2 Å²	101.2	69%	0.693	52%	0.516	S	S	*	.	H	α-helix	trans	-60.7	-43.2	179.3	-172.5	-96.3	0	0	0	112.2	A36 I37 S38 S44	A36-F40 PolarHBondContact O-N 2.95Å; I37-F40 PolarHBondContact O-N 3.39Å; S38-F40 PolarHBondContact O-N 3.31Å; F40-S44 WeakPolarHBondContact O-CB 3.18Å; F40-S44 PolarHBondContact O-N 3.06Å
41	Q	89.5	Confident	89.4	Confident	123 Å²	123	102.6 Å²	102.6	58%	0.575	52%	0.519	S	S	*	.	H	α-helix	trans	-61.4	-44.6	175.4	-71.7	176.9	14.1	0	0	111.9	I37 S38 M39 S44 W45	I37-Q41 HydrophobicContact CG2-CG 4.36Å; I37-Q41 VanDerWaalsContact O-CG 3.31Å; I37-Q41 WeakPolarHBondContact O-CG 3.31Å; I37-Q41 PolarHBondContact O-N 3.37Å; S38-Q41 PolarHBondContact O-N 2.97Å; M39-Q41 VanDerWaalsContact C-N 3.33Å; M39-Q41 PolarHBondContact O-N 3.42Å; Q41-S44 PolarHBondContact O-N 3.27Å; Q41-W45 WeakPolarHBondContact O-CB 3.4Å; Q41-W45 PolarHBondContact O-N 3.03Å
42	Y	92.4	Very high	88.7	Confident	128 Å²	128	99.5 Å²	99.5	50%	0.502	51%	0.509	S	S	.	.	H	α-helix	trans	-60.1	-48.7	179	178.9	-99.3	0	0	0	112.2	S38 M39 S44 W45 W46	S38-Y42 PolarHBondContact O-N 3.48Å; M39-Y42 PolarHBondContact O-N 3.19Å; Y42-S44 PolarHBondContact O-N 3.33Å; Y42-W45 PolarHBondContact O-N 2.94Å; Y42-W46 WeakPolarHBondContact O-CB 3.49Å; Y42-W46 PolarHBondContact O-N 3.46Å
43	F	89.2	Confident	87.9	Confident	139 Å²	139	98.9 Å²	98.9	61%	0.61	50%	0.502	S	S	*	.	H	α-helix	trans	-64.2	-39.6	178.3	-79.3	-70.8	0	0	0	112.7	M39 W45 W46 N47	M39-F43 WeakPolarHBondContact O-CD2 3.37Å; M39-F43 PolarHBondContact O-N 3.17Å; F43-W45 VanDerWaalsContact C-N 3.35Å; F43-W46 PolarHBondContact O-N 3.44Å; F43-N47 WeakPolarHBondContact O-CB 3.41Å; F43-N47 PolarHBondContact O-N 2.95Å
44	S	85.9	Confident	86.8	Confident	64 Å²	64	99.6 Å²	99.6	45%	0.448	51%	0.507	S	S	.	.	H	α-helix	trans	-62.1	-43.3	176	-174.6	0	0	0	0	111.8	F40 Q41 Y42 S48	F40-S44 WeakPolarHBondContact O-CB 3.18Å; F40-S44 PolarHBondContact O-N 3.06Å; Q41-S44 PolarHBondContact O-N 3.27Å; Y42-S44 PolarHBondContact O-N 3.33Å; S44-S48 WeakPolarHBondContact O-CB 3.43Å; S44-S48 PolarHBondContact O-N 2.82Å; S44-S48 PolarHBondContact O-OG 3.01Å
45	W	84.5	Confident	85.8	Confident	178 Å²	178	102.7 Å²	102.7	67%	0.674	51%	0.51	S	S	*	.	H	α-helix	trans	-68.2	-43.8	178.4	-166.8	65.2	0	0	0	112.2	Q41 Y42 F43 N47 S48 Y49	Q41-W45 WeakPolarHBondContact O-CB 3.4Å; Q41-W45 PolarHBondContact O-N 3.03Å; Y42-W45 PolarHBondContact O-N 2.94Å; F43-W45 VanDerWaalsContact C-N 3.35Å; W45-N47 VanDerWaalsContact C-N 3.35Å; W45-N47 PolarHBondContact O-N 3.35Å; W45-S48 PolarHBondContact O-N 3.22Å; W45-Y49 WeakPolarHBondContact O-CB 3.39Å; W45-Y49 PolarHBondContact O-N 2.92Å
46	W	84.4	Confident	84.4	Confident	135 Å²	135	102.6 Å²	102.6	51%	0.511	50%	0.504	S	S	.	.	H	α-helix	trans	-57.2	-46.9	175.6	-174.5	-99.2	0	0	0	112	Y42 F43 S48 Y49 N50	Y42-W46 WeakPolarHBondContact O-CB 3.49Å; Y42-W46 PolarHBondContact O-N 3.46Å; F43-W46 PolarHBondContact O-N 3.44Å; W46-S48 VanDerWaalsContact C-N 3.35Å; W46-S48 PolarHBondContact O-N 3.49Å; W46-Y49 PolarHBondContact O-N 2.91Å; W46-N50 VanDerWaalsContact CD1-ND2 3.25Å; W46-N50 PolarHBondContact NE1-ND2 2.86Å; W46-N50 PolarHBondContact O-N 2.95Å; W46-N50 PolarHBondContact O-ND2 3.42Å
47	N	78.1	Confident	83.1	Confident	82 Å²	82	103.1 Å²	103.1	44%	0.439	51%	0.508	S	S	.	.	H	α-helix	trans	-64.9	-40	178	-166.6	29.1	0	0	0	111.9	F43 W45 K51	F43-N47 WeakPolarHBondContact O-CB 3.41Å; F43-N47 PolarHBondContact O-N 2.95Å; W45-N47 VanDerWaalsContact C-N 3.35Å; W45-N47 PolarHBondContact O-N 3.35Å; N47-K51 PolarHBondContact ND2-NZ 3.04Å; N47-K51 WeakPolarHBondContact O-CB 3.23Å; N47-K51 VanDerWaalsContact O-CG 3.23Å; N47-K51 WeakPolarHBondContact O-CG 3.4Å; N47-K51 PolarHBondContact O-N 3.46Å; N47-K51 WeakPolarHBondContact OD1-CE 3.39Å
48	S	82.4	Confident	81.9	Confident	65 Å²	65	103.1 Å²	103.1	46%	0.455	51%	0.513	S	S	.	.	H	α-helix	trans	-65.6	-41.6	177.1	-60	0	0	0	0	111.9	S44 W45 W46 K51 A52	S44-S48 WeakPolarHBondContact O-CB 3.43Å; S44-S48 PolarHBondContact O-N 2.82Å; S44-S48 PolarHBondContact O-OG 3.01Å; W45-S48 PolarHBondContact O-N 3.22Å; W46-S48 VanDerWaalsContact C-N 3.35Å; W46-S48 PolarHBondContact O-N 3.49Å; S48-K51 PolarHBondContact O-N 2.91Å; S48-A52 WeakPolarHBondContact O-CB 3.31Å; S48-A52 PolarHBondContact O-N 3.43Å
49	Y	78.7	Confident	80.6	Confident	126 Å²	126	101.4 Å²	101.4	49%	0.494	50%	0.5	S	S	.	.	H	α-helix	trans	-62.3	-49.5	176.2	-173.1	-98.6	0	0	0	111.4	W45 W46 K51 A52 I53	W45-Y49 WeakPolarHBondContact O-CB 3.39Å; W45-Y49 PolarHBondContact O-N 2.92Å; W46-Y49 PolarHBondContact O-N 2.91Å; Y49-K51 VanDerWaalsContact C-N 3.33Å; Y49-K51 PolarHBondContact O-N 2.99Å; Y49-A52 PolarHBondContact O-N 3.34Å; Y49-I53 HydrophobicContact CD1-CG1 4.03Å; Y49-I53 HydrophobicContact CE1-CD1 4.27Å; Y49-I53 HydrophobicContact CE1-CG1 3.68Å; Y49-I53 HydrophobicContact CE2-CD1 4.42Å; Y49-I53 HydrophobicContact CE2-CG1 4.37Å; Y49-I53 WeakPolarHBondContact O-CG1 3.31Å; Y49-I53 PolarHBondContact O-N 3.49Å
50	N	79.7	Confident	79	Confident	69 Å²	69	100.1 Å²	100.1	37%	0.369	50%	0.499	S	S	.	.	H	α-helix	trans	-61.7	-40.3	178.7	-71	-27.4	0	0	0	112.5	W46 S54	W46-N50 VanDerWaalsContact CD1-ND2 3.25Å; W46-N50 PolarHBondContact NE1-ND2 2.86Å; W46-N50 PolarHBondContact O-N 2.95Å; W46-N50 PolarHBondContact O-ND2 3.42Å; N50-S54 VanDerWaalsContact O-CB 3.3Å; N50-S54 WeakPolarHBondContact O-CB 3.46Å; N50-S54 PolarHBondContact O-N 3.44Å
51	K	79.6	Confident	77.7	Confident	131 Å²	131	99.1 Å²	99.1	57%	0.57	50%	0.495	S	S	*	.	H	α-helix	trans	-62.6	-44.8	174.4	-75.9	173.5	-179.8	-179.2	0	111.9	N47 S48 Y49 S54 Y55	N47-K51 PolarHBondContact ND2-NZ 3.04Å; N47-K51 WeakPolarHBondContact O-CB 3.23Å; N47-K51 VanDerWaalsContact O-CG 3.23Å; N47-K51 WeakPolarHBondContact O-CG 3.4Å; N47-K51 PolarHBondContact O-N 3.46Å; N47-K51 WeakPolarHBondContact OD1-CE 3.39Å; S48-K51 PolarHBondContact O-N 2.91Å; Y49-K51 VanDerWaalsContact C-N 3.33Å; Y49-K51 PolarHBondContact O-N 2.99Å; K51-S54 PolarHBondContact O-N 3.29Å; K51-Y55 VanDerWaalsContact O-CB 3.31Å; K51-Y55 WeakPolarHBondContact O-CB 3.31Å; K51-Y55 PolarHBondContact O-N 3.42Å
52	A	80.6	Confident	76.4	Confident	49 Å²	49	98.4 Å²	98.4	41%	0.405	49%	0.488	S	S	.	.	H	α-helix	trans	-63.1	-46.3	178.1	0	0	0	0	0	111.5	S48 Y49 Y55 L56	S48-A52 WeakPolarHBondContact O-CB 3.31Å; S48-A52 PolarHBondContact O-N 3.43Å; Y49-A52 PolarHBondContact O-N 3.34Å; A52-Y55 PolarHBondContact O-N 3Å; A52-L56 WeakPolarHBondContact O-CB 3.3Å; A52-L56 VanDerWaalsContact O-CG 3.26Å; A52-L56 WeakPolarHBondContact O-CG 3.5Å; A52-L56 PolarHBondContact O-N 3.25Å
53	I	77.3	Confident	74.9	Confident	79 Å²	79	99.8 Å²	99.8	41%	0.405	49%	0.492	S	S	.	.	H	α-helix	trans	-62.4	-46.1	177.1	-66.3	-62.7	0	0	0	111.2	Y49 Y55 L56 A57	Y49-I53 HydrophobicContact CD1-CG1 4.03Å; Y49-I53 HydrophobicContact CE1-CD1 4.27Å; Y49-I53 HydrophobicContact CE1-CG1 3.68Å; Y49-I53 HydrophobicContact CE2-CD1 4.42Å; Y49-I53 HydrophobicContact CE2-CG1 4.37Å; Y49-I53 WeakPolarHBondContact O-CG1 3.31Å; Y49-I53 PolarHBondContact O-N 3.49Å; I53-Y55 VanDerWaalsContact C-N 3.28Å; I53-Y55 PolarHBondContact O-N 3.41Å; I53-L56 PolarHBondContact O-N 2.94Å; I53-A57 VanDerWaalsContact O-CB 3.28Å; I53-A57 WeakPolarHBondContact O-CB 3.42Å; I53-A57 PolarHBondContact O-N 3.35Å
54	S	71.9	Confident	73.7	Confident	73 Å²	73	98.1 Å²	98.1	51%	0.51	49%	0.488	S	S	.	.	H	α-helix	trans	-62.2	-36.5	177.7	-173.3	0	0	0	0	112.1	N50 K51 T58	N50-S54 VanDerWaalsContact O-CB 3.3Å; N50-S54 WeakPolarHBondContact O-CB 3.46Å; N50-S54 PolarHBondContact O-N 3.44Å; K51-S54 PolarHBondContact O-N 3.29Å; S54-T58 WeakPolarHBondContact O-CG2 3.41Å; S54-T58 PolarHBondContact O-N 3.42Å; S54-T58 PolarHBondContact O-OG1 2.94Å
55	Y	75.6	Confident	73	Confident	158 Å²	158	99.4 Å²	99.4	62%	0.62	49%	0.487	S	S	*	.	H	α-helix	trans	-70.6	-42.2	176.2	-176.2	-97.3	0	0	0	112.3	K51 A52 I53 A57 T58 V59	K51-Y55 VanDerWaalsContact O-CB 3.31Å; K51-Y55 WeakPolarHBondContact O-CB 3.31Å; K51-Y55 PolarHBondContact O-N 3.42Å; A52-Y55 PolarHBondContact O-N 3Å; I53-Y55 VanDerWaalsContact C-N 3.28Å; I53-Y55 PolarHBondContact O-N 3.41Å; Y55-A57 VanDerWaalsContact C-N 3.28Å; Y55-A57 PolarHBondContact O-N 2.93Å; Y55-T58 PolarHBondContact O-N 3.04Å; Y55-T58 PolarHBondContact O-OG1 3.36Å; Y55-V59 HydrophobicContact CE1-CG2 4.23Å; Y55-V59 WeakPolarHBondContact O-CG2 3.28Å; Y55-V59 PolarHBondContact O-N 2.94Å
56	L	68.3	Low	72.3	Confident	69 Å²	69	93.7 Å²	93.7	36%	0.361	48%	0.478	S	S	.	.	H	α-helix	trans	-65	-34.9	175.1	-68.9	171.8	0	0	0	111.5	A52 I53 V59 Y62	A52-L56 WeakPolarHBondContact O-CB 3.3Å; A52-L56 VanDerWaalsContact O-CG 3.26Å; A52-L56 WeakPolarHBondContact O-CG 3.5Å; A52-L56 PolarHBondContact O-N 3.25Å; I53-L56 PolarHBondContact O-N 2.94Å; L56-V59 PolarHBondContact O-N 3.36Å; L56-Y62 HydrophobicContact CD2-CD1 4.26Å; L56-Y62 HydrophobicContact CD2-CD2 3.56Å; L56-Y62 HydrophobicContact CD2-CE1 4.15Å; L56-Y62 HydrophobicContact CD2-CE2 3.45Å; L56-Y62 VanDerWaalsContact CD2-CE2 3.45Å; L56-Y62 HydrophobicContact CD2-CG 3.98Å
57	A	67.4	Low	71.5	Confident	59 Å²	59	90.9 Å²	90.9	49%	0.488	48%	0.476	S	S	.	.	H	α-helix	trans	-69.6	-31.9	177.2	0	0	0	0	0	113.3	I53 Y55 R63	I53-A57 VanDerWaalsContact O-CB 3.28Å; I53-A57 WeakPolarHBondContact O-CB 3.42Å; I53-A57 PolarHBondContact O-N 3.35Å; Y55-A57 VanDerWaalsContact C-N 3.28Å; Y55-A57 PolarHBondContact O-N 2.93Å; A57-R63 VanDerWaalsContact O-CD 3.29Å; A57-R63 WeakPolarHBondContact O-CD 3.46Å
58	T	70.4	Confident	71.2	Confident	97 Å²	97	92.5 Å²	92.5	60%	0.595	48%	0.481	S	S	*	.	H	α-helix	trans	-76.2	-26.3	176.6	53.9	0	0	0	0	112.5	S54 Y55 P60	S54-T58 WeakPolarHBondContact O-CG2 3.41Å; S54-T58 PolarHBondContact O-N 3.42Å; S54-T58 PolarHBondContact O-OG1 2.94Å; Y55-T58 PolarHBondContact O-N 3.04Å; Y55-T58 PolarHBondContact O-OG1 3.36Å; T58-P60 VanDerWaalsContact O-CD 3.32Å; T58-P60 WeakPolarHBondContact O-CD 3.36Å
59	V	68.7	Low	71	Confident	36 Å²	36	93.2 Å²	93.2	22%	0.218	48%	0.479	C	S	.	.			trans	-78.7	116.2	-179	172.7	0	0	0	0	110.4	Y55 L56 K61 Y62 R63	Y55-V59 HydrophobicContact CE1-CG2 4.23Å; Y55-V59 WeakPolarHBondContact O-CG2 3.28Å; Y55-V59 PolarHBondContact O-N 2.94Å; L56-V59 PolarHBondContact O-N 3.36Å; V59-K61 HydrophobicContact CG1-CB 3.92Å; V59-K61 PolarHBondContact O-N 3.1Å; V59-Y62 HydrophobicContact CB-CD2 3.75Å; V59-Y62 HydrophobicContact CB-CE2 4.25Å; V59-Y62 HydrophobicContact CG1-CD2 3.53Å; V59-Y62 HydrophobicContact CG1-CE2 3.82Å; V59-Y62 PolarHBondContact O-N 3.01Å; V59-R63 PolarHBondContact O-N 3.34Å
60	P	61.8	Low	70.6	Confident	84 Å²	84	88.5 Å²	88.5	55%	0.545	47%	0.465	S	S	.	.	H	α-helix	trans	-64.3	-26.5	-175.2	22.9	-31.6	0	0	0	113.4	T58 Y62 R63 I64	T58-P60 VanDerWaalsContact O-CD 3.32Å; T58-P60 WeakPolarHBondContact O-CD 3.36Å; P60-Y62 VanDerWaalsContact C-N 3.34Å; P60-Y62 PolarHBondContact O-N 3.22Å; P60-R63 WeakPolarHBondContact O-CB 3.36Å; P60-R63 PolarHBondContact O-N 3.37Å; P60-I64 WeakPolarHBondContact O-CG1 3.48Å; P60-I64 PolarHBondContact O-N 2.89Å
61	K	64.9	Low	70	Confident	137 Å²	137	92.8 Å²	92.8	60%	0.596	48%	0.481	S	S	*	.	H	α-helix	trans	-58.1	-42.5	176.5	-174.6	-179.5	178.6	-178.7	0	112.6	V59 Q65	V59-K61 HydrophobicContact CG1-CB 3.92Å; V59-K61 PolarHBondContact O-N 3.1Å; K61-Q65 PolarHBondContact O-N 3.11Å
62	Y	62	Low	69.8	Low	109 Å²	109	94.6 Å²	94.6	43%	0.427	49%	0.491	S	S	.	.	H	α-helix	trans	-78.9	-28	179.7	-63.3	-70.4	0	0	0	112.4	L56 V59 P60 Q65 A66	L56-Y62 HydrophobicContact CD2-CD1 4.26Å; L56-Y62 HydrophobicContact CD2-CD2 3.56Å; L56-Y62 HydrophobicContact CD2-CE1 4.15Å; L56-Y62 HydrophobicContact CD2-CE2 3.45Å; L56-Y62 VanDerWaalsContact CD2-CE2 3.45Å; L56-Y62 HydrophobicContact CD2-CG 3.98Å; V59-Y62 HydrophobicContact CB-CD2 3.75Å; V59-Y62 HydrophobicContact CB-CE2 4.25Å; V59-Y62 HydrophobicContact CG1-CD2 3.53Å; V59-Y62 HydrophobicContact CG1-CE2 3.82Å; V59-Y62 PolarHBondContact O-N 3.01Å; P60-Y62 VanDerWaalsContact C-N 3.34Å; P60-Y62 PolarHBondContact O-N 3.22Å; Y62-Q65 PolarHBondContact O-N 2.69Å; Y62-A66 WeakPolarHBondContact O-CB 3.39Å; Y62-A66 PolarHBondContact O-N 3.04Å
63	R	62.5	Low	69.4	Low	157 Å²	157	98.5 Å²	98.5	59%	0.592	50%	0.501	S	S	*	.	H	α-helix	trans	-63	-47.1	171.6	-67.1	175	58.2	-174.2	-0.2	111.3	A57 V59 P60 Q65 A66 T67	A57-R63 VanDerWaalsContact O-CD 3.29Å; A57-R63 WeakPolarHBondContact O-CD 3.46Å; V59-R63 PolarHBondContact O-N 3.34Å; P60-R63 WeakPolarHBondContact O-CB 3.36Å; P60-R63 PolarHBondContact O-N 3.37Å; R63-Q65 VanDerWaalsContact C-N 3.34Å; R63-Q65 PolarHBondContact O-N 3.25Å; R63-A66 PolarHBondContact O-N 3.34Å; R63-T67 PolarHBondContact O-N 3.46Å; R63-T67 PolarHBondContact O-OG1 3.2Å
64	I	63.3	Low	69.1	Low	104 Å²	104	97.6 Å²	97.6	53%	0.533	51%	0.511	S	S	.	.	H	α-helix	trans	-59.8	-45.3	178.4	-65.5	166	0	0	0	110.4	P60 A66 T67 E68	P60-I64 WeakPolarHBondContact O-CG1 3.48Å; P60-I64 PolarHBondContact O-N 2.89Å; I64-A66 PolarHBondContact O-N 3.38Å; I64-T67 WeakPolarHBondContact O-CB 3.31Å; I64-T67 PolarHBondContact O-N 3.16Å; I64-T67 VanDerWaalsContact O-N 3.11Å; I64-E68 PolarHBondContact O-N 3Å
65	Q	70.3	Confident	69	Low	91 Å²	91	100.5 Å²	100.5	43%	0.425	52%	0.521	S	S	.	.	H	α-helix	trans	-61.4	-43.1	174.8	-73.7	-175.7	2.5	0	0	113	K61 Y62 R63 T67 E68 I69	K61-Q65 PolarHBondContact O-N 3.11Å; Y62-Q65 PolarHBondContact O-N 2.69Å; R63-Q65 VanDerWaalsContact C-N 3.34Å; R63-Q65 PolarHBondContact O-N 3.25Å; Q65-T67 PolarHBondContact O-N 3Å; Q65-E68 PolarHBondContact O-N 3.27Å; Q65-I69 WeakPolarHBondContact O-CB 3.31Å; Q65-I69 VanDerWaalsContact O-CG1 3.25Å; Q65-I69 WeakPolarHBondContact O-CG1 3.42Å; Q65-I69 PolarHBondContact O-N 3.47Å
66	A	70.1	Confident	68.3	Low	58 Å²	58	97.4 Å²	97.4	48%	0.479	51%	0.514	S	S	.	.	H	α-helix	trans	-62.2	-34.5	175.2	0	0	0	0	0	111.8	Y62 R63 I64 A70	Y62-A66 WeakPolarHBondContact O-CB 3.39Å; Y62-A66 PolarHBondContact O-N 3.04Å; R63-A66 PolarHBondContact O-N 3.34Å; I64-A66 PolarHBondContact O-N 3.38Å; A66-A70 VanDerWaalsContact O-CB 3.24Å; A66-A70 WeakPolarHBondContact O-CB 3.47Å; A66-A70 PolarHBondContact O-N 2.95Å
67	T	68.1	Low	67.8	Low	76 Å²	76	103.8 Å²	103.8	47%	0.466	54%	0.539	S	S	.	.	H	α-helix	trans	-72	-38.6	177	-27.7	0	0	0	0	111.4	R63 I64 Q65 K71 L76	R63-T67 PolarHBondContact O-N 3.46Å; R63-T67 PolarHBondContact O-OG1 3.2Å; I64-T67 WeakPolarHBondContact O-CB 3.31Å; I64-T67 PolarHBondContact O-N 3.16Å; I64-T67 VanDerWaalsContact O-N 3.11Å; Q65-T67 PolarHBondContact O-N 3Å; T67-K71 VanDerWaalsContact O-CB 3.31Å; T67-K71 WeakPolarHBondContact O-CB 3.3Å; T67-K71 PolarHBondContact O-N 3.21Å; T67-L76 HydrophobicContact CG2-CD1 3.89Å
68	E	72.8	Confident	66.9	Low	115 Å²	115	110.6 Å²	110.6	54%	0.537	56%	0.558	S	S	.	*	H	α-helix	trans	-63.8	-47.7	172.5	-89.1	174.4	158.8	0	0	111.9	I64 Q65 A70 K71 E72	I64-E68 PolarHBondContact O-N 3Å; Q65-E68 PolarHBondContact O-N 3.27Å; E68-A70 VanDerWaalsContact C-N 3.34Å; E68-A70 PolarHBondContact O-N 3.48Å; E68-K71 CarbonylContact O-C 3.6Å; E68-K71 WeakPolarHBondContact O-CA 3.35Å; E68-K71 WeakPolarHBondContact O-CB 3.04Å; E68-K71 PolarHBondContact O-N 3.43Å; E68-K71 VanDerWaalsContact O-N 3.1Å; E68-E72 PolarHBondContact O-N 3.08Å
69	I	76.4	Confident	65.9	Low	81 Å²	81	113.9 Å²	113.9	42%	0.415	59%	0.594	S	S	.	*	H	α-helix	trans	-61.5	-42.8	176.2	-65.9	164.3	0	0	0	110.6	Q65 K71 E72 Q73	Q65-I69 WeakPolarHBondContact O-CB 3.31Å; Q65-I69 VanDerWaalsContact O-CG1 3.25Å; Q65-I69 WeakPolarHBondContact O-CG1 3.42Å; Q65-I69 PolarHBondContact O-N 3.47Å; I69-K71 VanDerWaalsContact C-N 3.26Å; I69-K71 PolarHBondContact O-N 3.09Å; I69-E72 PolarHBondContact O-N 3.39Å; I69-Q73 HydrophobicContact CG2-CG 4.29Å; I69-Q73 WeakPolarHBondContact O-CB 3.4Å; I69-Q73 VanDerWaalsContact O-CG 3.27Å; I69-Q73 WeakPolarHBondContact O-CG 3.38Å; I69-Q73 PolarHBondContact O-N 3.47Å
70	A	70.3	Confident	65.8	Low	26 Å²	26	117.8 Å²	117.8	22%	0.215	61%	0.613	C	S	.	*	H	α-helix	trans	-66	-29.1	176.6	0	0	0	0	0	113	A66 E68 G74 L75 L76	A66-A70 VanDerWaalsContact O-CB 3.24Å; A66-A70 WeakPolarHBondContact O-CB 3.47Å; A66-A70 PolarHBondContact O-N 2.95Å; E68-A70 VanDerWaalsContact C-N 3.34Å; E68-A70 PolarHBondContact O-N 3.48Å; A70-G74 PolarHBondContact O-N 3.05Å; A70-L75 PolarHBondContact O-N 3.47Å; A70-L75 VanDerWaalsContact O-N 3.09Å; A70-L76 HydrophobicContact CB-CD1 3.95Å; A70-L76 HydrophobicContact CB-CG 4.05Å; A70-L76 PolarHBondContact O-N 3.27Å
71	K	68.8	Low	66	Low	160 Å²	160	119.5 Å²	119.5	70%	0.696	62%	0.617	S	S	*	*	H	α-helix	trans	-73.9	-41.1	173.6	-171.7	-178.6	177.4	-172.5	0	111.4	T67 E68 I69 G74 L76	T67-K71 VanDerWaalsContact O-CB 3.31Å; T67-K71 WeakPolarHBondContact O-CB 3.3Å; T67-K71 PolarHBondContact O-N 3.21Å; E68-K71 CarbonylContact O-C 3.6Å; E68-K71 WeakPolarHBondContact O-CA 3.35Å; E68-K71 WeakPolarHBondContact O-CB 3.04Å; E68-K71 PolarHBondContact O-N 3.43Å; E68-K71 VanDerWaalsContact O-N 3.1Å; I69-K71 VanDerWaalsContact C-N 3.26Å; I69-K71 PolarHBondContact O-N 3.09Å; K71-G74 PolarHBondContact O-N 3.23Å; K71-L76 HydrophobicContact CB-CD1 4.2Å
72	E	74.4	Confident	66.1	Low	168 Å²	168	118.6 Å²	118.6	79%	0.785	62%	0.618	S	S	*	*	H	α-helix	trans	-66.1	-38.8	174.3	-74.6	-175.8	165.4	0	0	112.4	E68 I69 G74	E68-E72 PolarHBondContact O-N 3.08Å; I69-E72 PolarHBondContact O-N 3.39Å; E72-G74 PolarHBondContact O-N 3.4Å
73	Q	73.3	Confident	66.3	Low	132 Å²	132	119.1 Å²	119.1	62%	0.617	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.5	-0.1	177.1	-68.9	179.8	-0.1	0	0	113.5	I69 L75	I69-Q73 HydrophobicContact CG2-CG 4.29Å; I69-Q73 WeakPolarHBondContact O-CB 3.4Å; I69-Q73 VanDerWaalsContact O-CG 3.27Å; I69-Q73 WeakPolarHBondContact O-CG 3.38Å; I69-Q73 PolarHBondContact O-N 3.47Å; Q73-L75 HydrophobicContact CB-CD1 4.12Å; Q73-L75 HydrophobicContact CB-CG 4.25Å; Q73-L75 PolarHBondContact O-N 3.42Å; Q73-L75 VanDerWaalsContact O-N 3.16Å
74	G	70.4	Confident	66.6	Low	60 Å²	60	116.8 Å²	116.8	62%	0.619	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	67.9	11.2	177.8	0	0	0	0	0	114.8	A70 K71 E72 L76	A70-G74 PolarHBondContact O-N 3.05Å; K71-G74 PolarHBondContact O-N 3.23Å; E72-G74 PolarHBondContact O-N 3.4Å; G74-L76 VanDerWaalsContact C-N 3.31Å
75	L	69.4	Low	66.8	Low	134 Å²	134	117.6 Å²	117.6	70%	0.702	64%	0.638	S	S	*	*			trans	-76.5	-20	-180	-69.5	168.5	0	0	0	112.4	A70 Q73 K77	A70-L75 PolarHBondContact O-N 3.47Å; A70-L75 VanDerWaalsContact O-N 3.09Å; Q73-L75 HydrophobicContact CB-CD1 4.12Å; Q73-L75 HydrophobicContact CB-CG 4.25Å; Q73-L75 PolarHBondContact O-N 3.42Å; Q73-L75 VanDerWaalsContact O-N 3.16Å; L75-K77 PolarHBondContact O-N 3.1Å
76	L	61.5	Low	66.5	Low	93 Å²	93	119.5 Å²	119.5	49%	0.487	65%	0.653	S	S	.	*	S	Bend	trans	-85.9	94	172.1	-74.7	170.3	0	0	0	110.1	T67 A70 K71 G74 K78	T67-L76 HydrophobicContact CG2-CD1 3.89Å; A70-L76 HydrophobicContact CB-CD1 3.95Å; A70-L76 HydrophobicContact CB-CG 4.05Å; A70-L76 PolarHBondContact O-N 3.27Å; K71-L76 HydrophobicContact CB-CD1 4.2Å; G74-L76 VanDerWaalsContact C-N 3.31Å; L76-K78 PolarHBondContact O-N 3.32Å; L76-K78 VanDerWaalsContact O-N 3.17Å
77	K	57.2	Low	66.2	Low	203 Å²	203	124.2 Å²	124.2	88%	0.883	67%	0.666	S	S	*	*			trans	-62.7	116.1	166.2	-157.2	-179.4	-172.3	-176	0	108.2	L75 A79	L75-K77 PolarHBondContact O-N 3.1Å; K77-A79 PolarHBondContact O-N 3.14Å
78	K	49.5	Very low	66.1	Low	202 Å²	202	128.3 Å²	128.3	88%	0.878	68%	0.683	S	S	*	*			trans	-58.8	115.5	173.2	-165.2	177.7	-176.8	-175.9	0	108.2	L76	L76-K78 PolarHBondContact O-N 3.32Å; L76-K78 VanDerWaalsContact O-N 3.17Å
79	A	49.3	Very low	65.5	Low	165 Å²	165	129.5 Å²	129.5	100%	1.364	70%	0.696	S	S	*	*			trans	-76.6	0	160.1	0	0	0	0	0	108.8	K77	K77-A79 PolarHBondContact O-N 3.14Å

Retrieved 79 of 79 residues in 170.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).