Z4YMG1_MOUSE Loading...

Chloride channel CLIC-like protein 1

AlphaFold DB , UniProt , Accession Z4YMG1, Species MOUSE (Mus musculus, Mouse), Gene Clcc1, Length 84 aa.

						>Z4YMG1_MOUSE|Z4YMG1|Clcc1
MLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQVRSGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKVDSCEKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.4	Confident	78.8	Confident	200 Å²	200	120.5 Å²	120.5	99%	0.985	62%	0.624	S	S	*	*				0	-35.3	0	-57.9	-147.1	90.1	0	0	112.5	C3 R4 L5	M1-C3 VanDerWaalsContact C-N 3.32Å; M1-C3 PolarHBondContact O-N 3.23Å; M1-R4 PolarHBondContact O-N 3.29Å; M1-R4 VanDerWaalsContact O-N 3.13Å; M1-L5 PolarHBondContact O-N 3.13Å
2	L	77.8	Confident	78.4	Confident	133 Å²	133	118.8 Å²	118.8	70%	0.696	62%	0.616	S	S	*	*	H	α-helix	trans	-50.6	-43.8	172.9	-106.8	87	0	0	0	114.3	R4 L5 L6	L2-R4 VanDerWaalsContact C-N 3.25Å; L2-R4 PolarHBondContact O-N 3.47Å; L2-L5 PolarHBondContact O-N 2.99Å; L2-L5 VanDerWaalsContact O-N 3.11Å; L2-L6 WeakPolarHBondContact O-CG 3.47Å; L2-L6 PolarHBondContact O-N 3.12Å
3	C	73.8	Confident	77.8	Confident	93 Å²	93	119.3 Å²	119.3	63%	0.628	62%	0.619	S	S	*	*	H	α-helix	trans	-61.3	-31.3	-179.3	-65.5	0	0	0	0	113.7	M1 L7	M1-C3 VanDerWaalsContact C-N 3.32Å; M1-C3 PolarHBondContact O-N 3.23Å; C3-L7 WeakPolarHBondContact O-CB 3.34Å; C3-L7 WeakPolarHBondContact O-CD1 3.42Å; C3-L7 WeakPolarHBondContact O-CG 3.45Å; C3-L7 PolarHBondContact O-N 3.38Å
4	R	80.5	Confident	76.9	Confident	201 Å²	201	118.8 Å²	118.8	76%	0.758	62%	0.616	S	S	*	*	H	α-helix	trans	-72.5	-36.2	176.5	-69.9	-163.7	-179.2	-161.1	1.6	111.9	M1 L2 C8	M1-R4 PolarHBondContact O-N 3.29Å; M1-R4 VanDerWaalsContact O-N 3.13Å; L2-R4 VanDerWaalsContact C-N 3.25Å; L2-R4 PolarHBondContact O-N 3.47Å; R4-C8 WeakPolarHBondContact O-CB 3.46Å; R4-C8 PolarHBondContact O-N 3.42Å
5	L	81.9	Confident	76	Confident	119 Å²	119	117.2 Å²	117.2	62%	0.623	61%	0.614	S	S	*	*	H	α-helix	trans	-67.2	-44.5	174.3	-64.6	172.1	0	0	0	110.6	M1 L2 L7 C8 E9	M1-L5 PolarHBondContact O-N 3.13Å; L2-L5 PolarHBondContact O-N 2.99Å; L2-L5 VanDerWaalsContact O-N 3.11Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L5-L7 PolarHBondContact O-N 3.27Å; L5-C8 WeakPolarHBondContact O-CB 3.18Å; L5-C8 PolarHBondContact O-N 2.89Å; L5-C8 VanDerWaalsContact O-N 3.12Å; L5-E9 WeakPolarHBondContact O-CG 3.43Å; L5-E9 PolarHBondContact O-N 3Å
6	L	81.6	Confident	75	Confident	104 Å²	104	112.7 Å²	112.7	55%	0.545	60%	0.604	S	S	.	*	H	α-helix	trans	-59.5	-43.8	175.1	-70.8	170.3	0	0	0	112.1	L2 C8 E9 C10	L2-L6 WeakPolarHBondContact O-CG 3.47Å; L2-L6 PolarHBondContact O-N 3.12Å; L6-C8 VanDerWaalsContact C-N 3.31Å; L6-C8 PolarHBondContact O-N 3.11Å; L6-E9 PolarHBondContact O-N 3.03Å; L6-C10 PolarHBondContact O-N 3.49Å; L6-C10 PolarHBondContact O-SG 3.03Å
7	L	82.6	Confident	73.9	Confident	111 Å²	111	118.4 Å²	118.4	58%	0.581	62%	0.617	S	S	*	*	H	α-helix	trans	-64	-36.6	175.6	-72	168	0	0	0	112.3	C3 L5 C10 L11	C3-L7 WeakPolarHBondContact O-CB 3.34Å; C3-L7 WeakPolarHBondContact O-CD1 3.42Å; C3-L7 WeakPolarHBondContact O-CG 3.45Å; C3-L7 PolarHBondContact O-N 3.38Å; L5-L7 VanDerWaalsContact C-N 3.34Å; L5-L7 PolarHBondContact O-N 3.27Å; L7-C10 PolarHBondContact O-N 2.98Å; L7-L11 VanDerWaalsContact O-CG 3.23Å; L7-L11 WeakPolarHBondContact O-CG 3.35Å; L7-L11 PolarHBondContact O-N 3.41Å
8	C	80.9	Confident	73	Confident	66 Å²	66	116.2 Å²	116.2	45%	0.446	62%	0.619	S	S	.	*	H	α-helix	trans	-63.3	-48.3	176.2	-171.7	0	0	0	0	111.6	R4 L5 L6 C10 L11 L12	R4-C8 WeakPolarHBondContact O-CB 3.46Å; R4-C8 PolarHBondContact O-N 3.42Å; L5-C8 WeakPolarHBondContact O-CB 3.18Å; L5-C8 PolarHBondContact O-N 2.89Å; L5-C8 VanDerWaalsContact O-N 3.12Å; L6-C8 VanDerWaalsContact C-N 3.31Å; L6-C8 PolarHBondContact O-N 3.11Å; C8-C10 PolarHBondContact O-N 3.49Å; C8-L11 PolarHBondContact O-N 3.45Å; C8-L12 WeakPolarHBondContact O-CG 3.23Å; C8-L12 PolarHBondContact O-N 2.78Å; C8-L12 VanDerWaalsContact O-N 3.08Å
9	E	78.8	Confident	72.1	Confident	114 Å²	114	117.9 Å²	117.9	53%	0.533	62%	0.623	S	S	.	*	H	α-helix	trans	-61.4	-43.4	176.5	-66.3	-60.3	150.1	0	0	111.8	L5 L6 L11 L12 L13	L5-E9 WeakPolarHBondContact O-CG 3.43Å; L5-E9 PolarHBondContact O-N 3Å; L6-E9 PolarHBondContact O-N 3.03Å; E9-L11 VanDerWaalsContact C-N 3.32Å; E9-L11 PolarHBondContact O-N 3.2Å; E9-L12 PolarHBondContact O-N 3.12Å; E9-L13 WeakPolarHBondContact O-CG 3.41Å; E9-L13 PolarHBondContact O-N 3.42Å
10	C	79	Confident	71.4	Confident	68 Å²	68	118.1 Å²	118.1	46%	0.459	62%	0.624	S	S	.	*	H	α-helix	trans	-60.7	-40.2	176.5	-68.8	0	0	0	0	112.4	L6 L7 C8 L13 I14	L6-C10 PolarHBondContact O-N 3.49Å; L6-C10 PolarHBondContact O-SG 3.03Å; L7-C10 PolarHBondContact O-N 2.98Å; C8-C10 PolarHBondContact O-N 3.49Å; C10-L13 PolarHBondContact O-N 3.49Å; C10-I14 WeakPolarHBondContact O-CD1 3.37Å; C10-I14 WeakPolarHBondContact O-CG1 3.21Å; C10-I14 PolarHBondContact O-N 3.13Å; C10-I14 VanDerWaalsContact O-N 3.13Å
11	L	79.1	Confident	70.7	Confident	116 Å²	116	119.4 Å²	119.4	61%	0.607	63%	0.631	S	S	*	*	H	α-helix	trans	-65.9	-39.8	177.2	-71.3	169.4	0	0	0	111.9	L7 C8 E9 I14 T15	L7-L11 VanDerWaalsContact O-CG 3.23Å; L7-L11 WeakPolarHBondContact O-CG 3.35Å; L7-L11 PolarHBondContact O-N 3.41Å; C8-L11 PolarHBondContact O-N 3.45Å; E9-L11 VanDerWaalsContact C-N 3.32Å; E9-L11 PolarHBondContact O-N 3.2Å; L11-I14 PolarHBondContact O-N 3.16Å; L11-T15 PolarHBondContact O-N 3.08Å; L11-T15 VanDerWaalsContact O-N 3.12Å; L11-T15 PolarHBondContact O-OG1 3.46Å
12	L	73.9	Confident	70.3	Confident	101 Å²	101	115.9 Å²	115.9	53%	0.529	62%	0.616	S	S	.	*	H	α-helix	trans	-65.8	-41.2	177.1	-68.8	171.3	0	0	0	112.3	C8 E9 I14 T15 G16	C8-L12 WeakPolarHBondContact O-CG 3.23Å; C8-L12 PolarHBondContact O-N 2.78Å; C8-L12 VanDerWaalsContact O-N 3.08Å; E9-L12 PolarHBondContact O-N 3.12Å; L12-I14 PolarHBondContact O-N 3.5Å; L12-T15 WeakPolarHBondContact CA-OG1 3.36Å; L12-T15 PolarHBondContact O-N 3.26Å; L12-T15 PolarHBondContact O-OG1 3.01Å; L12-G16 PolarHBondContact O-N 3.37Å; L12-G16 VanDerWaalsContact O-N 3.15Å
13	L	70.8	Confident	69.8	Low	125 Å²	125	118.7 Å²	118.7	65%	0.654	62%	0.618	S	S	*	*	H	α-helix	trans	-63.3	-40.2	176.3	-71.9	168.1	0	0	0	112.1	E9 C10 G16 Y17	E9-L13 WeakPolarHBondContact O-CG 3.41Å; E9-L13 PolarHBondContact O-N 3.42Å; C10-L13 PolarHBondContact O-N 3.49Å; L13-G16 PolarHBondContact O-N 3.08Å; L13-Y17 WeakPolarHBondContact O-CB 3.43Å; L13-Y17 PolarHBondContact O-N 3.37Å; L13-Y17 VanDerWaalsContact O-N 3.08Å
14	I	66.2	Low	69.3	Low	112 Å²	112	120.1 Å²	120.1	57%	0.574	62%	0.618	S	S	*	*	H	α-helix	trans	-68.4	-38	178.7	-66	163.3	0	0	0	111.1	C10 L11 L12 G16 Y17 A18	C10-I14 WeakPolarHBondContact O-CD1 3.37Å; C10-I14 WeakPolarHBondContact O-CG1 3.21Å; C10-I14 PolarHBondContact O-N 3.13Å; C10-I14 VanDerWaalsContact O-N 3.13Å; L11-I14 PolarHBondContact O-N 3.16Å; L12-I14 PolarHBondContact O-N 3.5Å; I14-G16 VanDerWaalsContact C-N 3.31Å; I14-G16 PolarHBondContact O-N 2.99Å; I14-Y17 PolarHBondContact O-N 3.15Å; I14-A18 WeakPolarHBondContact O-CB 3.48Å; I14-A18 PolarHBondContact O-N 3.24Å
15	T	63	Low	68.9	Low	95 Å²	95	113.3 Å²	113.3	58%	0.583	60%	0.597	S	S	*	*	H	α-helix	trans	-67.9	-29.3	176.6	45.8	0	0	0	0	113.5	L11 L12	L11-T15 PolarHBondContact O-N 3.08Å; L11-T15 VanDerWaalsContact O-N 3.12Å; L11-T15 PolarHBondContact O-OG1 3.46Å; L12-T15 WeakPolarHBondContact CA-OG1 3.36Å; L12-T15 PolarHBondContact O-N 3.26Å; L12-T15 PolarHBondContact O-OG1 3.01Å
16	G	59	Low	68.3	Low	45 Å²	45	112.3 Å²	112.3	46%	0.464	60%	0.597	S	S	.	*	H	α-helix	trans	-76	-30.7	172.2	0	0	0	0	0	113.1	L12 L13 I14	L12-G16 PolarHBondContact O-N 3.37Å; L12-G16 VanDerWaalsContact O-N 3.15Å; L13-G16 PolarHBondContact O-N 3.08Å; I14-G16 VanDerWaalsContact C-N 3.31Å; I14-G16 PolarHBondContact O-N 2.99Å
17	Y	57.4	Low	68	Low	210 Å²	210	110.9 Å²	110.9	82%	0.824	59%	0.593	S	S	*	*	H	α-helix	trans	-82.8	-25.7	-179.1	-164	-97.6	0	0	0	113.9	L13 I14	L13-Y17 WeakPolarHBondContact O-CB 3.43Å; L13-Y17 PolarHBondContact O-N 3.37Å; L13-Y17 VanDerWaalsContact O-N 3.08Å; I14-Y17 PolarHBondContact O-N 3.15Å
18	A	57.3	Low	67.6	Low	79 Å²	79	107.6 Å²	107.6	65%	0.653	58%	0.576	S	S	*	*	S	Bend	trans	-85.7	-9.8	178.5	0	0	0	0	0	113.6	I14 D20	I14-A18 WeakPolarHBondContact O-CB 3.48Å; I14-A18 PolarHBondContact O-N 3.24Å; A18-D20 PolarHBondContact O-N 2.94Å
19	H	56.6	Low	67.4	Low	148 Å²	148	111.3 Å²	111.3	69%	0.685	59%	0.589	S	S	*	*	S	Bend	trans	-86	97.9	157.9	-141.1	48.3	0	0	0	103.9	D21	H19-D21 PolarHBondContact O-N 3.44Å
20	D	57	Low	67.5	Low	121 Å²	121	112.9 Å²	112.9	65%	0.647	60%	0.6	S	S	*	*			trans	-44.2	117.1	160.6	-80.7	-60.1	0	0	0	105.2	A18 D22	A18-D20 PolarHBondContact O-N 2.94Å; D20-D22 PolarHBondContact O-N 3.46Å
21	D	56.9	Low	67.5	Low	146 Å²	146	112.8 Å²	112.8	78%	0.781	60%	0.595	S	S	*	*			trans	-65.8	65.8	166.1	-79.1	-45	0	0	0	106.1	H19 W23	H19-D21 PolarHBondContact O-N 3.44Å; D21-W23 PolarHBondContact O-N 2.68Å
22	D	62.2	Low	67.6	Low	126 Å²	126	113 Å²	113	67%	0.674	59%	0.589	S	S	*	*			trans	-66.8	73.6	164	-77.7	-25.1	0	0	0	104	D20 I24	D20-D22 PolarHBondContact O-N 3.46Å; D22-I24 WeakPolarHBondContact O-CG1 3.35Å; D22-I24 PolarHBondContact O-N 2.92Å
23	W	67.5	Low	68	Low	193 Å²	193	111.2 Å²	111.2	73%	0.731	58%	0.58	S	S	*	*			trans	-49	112.3	169.4	81.1	-74	0	0	0	105.1	D21 D25	D21-W23 PolarHBondContact O-N 2.68Å; W23-D25 HydrophobicContact CH2-CB 4.06Å; W23-D25 HydrophobicContact CZ2-CB 4.5Å; W23-D25 HydrophobicContact CZ3-CB 4.39Å; W23-D25 PolarHBondContact O-N 2.73Å
24	I	63.8	Low	68.6	Low	122 Å²	122	109.5 Å²	109.5	63%	0.626	58%	0.583	S	S	*	*			trans	-73	119.7	-176.6	-66.9	170.3	0	0	0	105	D22 D28	D22-I24 WeakPolarHBondContact O-CG1 3.35Å; D22-I24 PolarHBondContact O-N 2.92Å; I24-D28 HydrophobicContact CG2-CB 3.79Å
25	D	71.6	Confident	69.5	Low	58 Å²	58	108.9 Å²	108.9	31%	0.31	60%	0.595	S	S	.	*			trans	-57	131.3	173.5	-176.6	-38.2	0	0	0	106.7	W23 T27 D28	W23-D25 HydrophobicContact CH2-CB 4.06Å; W23-D25 HydrophobicContact CZ2-CB 4.5Å; W23-D25 HydrophobicContact CZ3-CB 4.39Å; W23-D25 PolarHBondContact O-N 2.73Å; D25-T27 PolarHBondContact O-N 3.47Å; D25-T27 WeakPolarHBondContact OD1-CB 3.19Å; D25-T27 PolarHBondContact OD1-N 3.26Å; D25-T27 PolarHBondContact OD1-OG1 3.01Å; D25-D28 PolarHBondContact N-OD2 3.1Å; D25-D28 VanDerWaalsContact O-CB 3.26Å; D25-D28 WeakPolarHBondContact O-CB 3.41Å; D25-D28 PolarHBondContact O-N 3.38Å
26	P	69.4	Low	70.5	Confident	98 Å²	98	107.2 Å²	107.2	64%	0.636	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.5	-25	175.5	-28.2	34.3	0	0	0	113.9
27	T	73.9	Confident	71.6	Confident	75 Å²	75	107 Å²	107	46%	0.46	58%	0.584	S	S	.	*	T	Hydrogen-bonded Turn	trans	-72.2	-28.8	175.2	-43.3	0	0	0	0	113.1	D25 M29 L30 N31	D25-T27 PolarHBondContact O-N 3.47Å; D25-T27 WeakPolarHBondContact OD1-CB 3.19Å; D25-T27 PolarHBondContact OD1-N 3.26Å; D25-T27 PolarHBondContact OD1-OG1 3.01Å; T27-M29 VanDerWaalsContact C-N 3.25Å; T27-M29 PolarHBondContact O-N 3.41Å; T27-L30 WeakPolarHBondContact O-CB 3.48Å; T27-L30 PolarHBondContact O-N 3.39Å; T27-L30 VanDerWaalsContact O-N 3.08Å; T27-N31 PolarHBondContact O-N 3.24Å
28	D	74.9	Confident	72.6	Confident	42 Å²	42	100.9 Å²	100.9	23%	0.225	57%	0.569	C	S	.	*	H	α-helix	trans	-65.9	-30.2	-179.9	-71.3	-25.8	0	0	0	112.3	I24 D25 L30 N31 Y32 M39	I24-D28 HydrophobicContact CG2-CB 3.79Å; D25-D28 PolarHBondContact N-OD2 3.1Å; D25-D28 VanDerWaalsContact O-CB 3.26Å; D25-D28 WeakPolarHBondContact O-CB 3.41Å; D25-D28 PolarHBondContact O-N 3.38Å; D28-L30 PolarHBondContact O-N 3.48Å; D28-N31 CarbonylContact O-C 3.41Å; D28-N31 WeakPolarHBondContact O-CA 3.43Å; D28-N31 PolarHBondContact O-N 3.13Å; D28-Y32 PolarHBondContact O-N 2.86Å; D28-M39 HydrophobicContact CB-CE 3.53Å; D28-M39 HydrophobicContact CB-SD 4.02Å; D28-M39 WeakPolarHBondContact OD1-CE 3.45Å
29	M	77.9	Confident	73.4	Confident	143 Å²	143	101.4 Å²	101.4	70%	0.704	56%	0.559	S	S	*	*	H	α-helix	trans	-64.5	-29.8	174.3	-169.9	175.8	58.1	0	0	112.1	T27 N31 Y32	T27-M29 VanDerWaalsContact C-N 3.25Å; T27-M29 PolarHBondContact O-N 3.41Å; M29-N31 VanDerWaalsContact C-N 3.32Å; M29-Y32 PolarHBondContact O-N 2.77Å
30	L	79.8	Confident	74.2	Confident	147 Å²	147	103 Å²	103	77%	0.77	56%	0.559	S	S	*	*	H	α-helix	trans	-74.1	-25.4	172.6	-62.9	173.9	0	0	0	112.3	T27 D28	T27-L30 WeakPolarHBondContact O-CB 3.48Å; T27-L30 PolarHBondContact O-N 3.39Å; T27-L30 VanDerWaalsContact O-N 3.08Å; D28-L30 PolarHBondContact O-N 3.48Å
31	N	78.9	Confident	74.7	Confident	67 Å²	67	106.7 Å²	106.7	36%	0.358	57%	0.569	S	S	.	*	H	α-helix	trans	-90.9	-3.9	175.8	-71	-39.1	0	0	0	113	T27 D28 M29 R40	T27-N31 PolarHBondContact O-N 3.24Å; D28-N31 CarbonylContact O-C 3.41Å; D28-N31 WeakPolarHBondContact O-CA 3.43Å; D28-N31 PolarHBondContact O-N 3.13Å; M29-N31 VanDerWaalsContact C-N 3.32Å; N31-R40 WeakPolarHBondContact O-CB 3.38Å; N31-R40 WeakPolarHBondContact O-CG 3.33Å; N31-R40 PolarHBondContact O-N 2.82Å
32	Y	82.2	Confident	75	Confident	121 Å²	121	104.2 Å²	104.2	48%	0.475	56%	0.564	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-79.5	123.2	178.2	-170.2	-99.6	0	0	0	110.7	D28 M29 G37 M39	D28-Y32 PolarHBondContact O-N 2.86Å; M29-Y32 PolarHBondContact O-N 2.77Å; Y32-G37 VanDerWaalsContact OH-CA 3.26Å; Y32-G37 WeakPolarHBondContact OH-CA 3.43Å; Y32-G37 PolarHBondContact OH-O 3.13Å; Y32-M39 HydrophobicContact CD2-CG 4.2Å
33	D	82.2	Confident	74.8	Confident	63 Å²	63	107.2 Å²	107.2	34%	0.337	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.2	109.7	172.3	170.8	20.4	0	0	0	109.7	A35 S36 G37 T38 R40	D33-A35 PolarHBondContact O-N 3.49Å; D33-A35 WeakPolarHBondContact OD1-CB 3.5Å; D33-A35 PolarHBondContact OD1-N 2.97Å; D33-S36 WeakPolarHBondContact CB-OG 3.44Å; D33-S36 PolarHBondContact O-N 3.13Å; D33-S36 PolarHBondContact O-OG 3.13Å; D33-S36 VanDerWaalsContact OD2-CB 3.29Å; D33-S36 WeakPolarHBondContact OD2-CB 3.26Å; D33-S36 PolarHBondContact OD2-OG 3.35Å; D33-G37 WeakPolarHBondContact O-CA 3.43Å; D33-G37 PolarHBondContact O-N 3.29Å; D33-T38 PolarHBondContact N-O 3.08Å; D33-T38 VanDerWaalsContact N-O 3.11Å; D33-R40 HydrophobicContact CB-CG 4.43Å
34	A	83	Confident	73.9	Confident	88 Å²	88	103.8 Å²	103.8	73%	0.727	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.1	-24.4	-179	0	0	0	0	0	113.6
35	A	85.5	Confident	73	Confident	99 Å²	99	108.2 Å²	108.2	82%	0.818	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-35.3	178.4	0	0	0	0	0	111.9	D33	D33-A35 PolarHBondContact O-N 3.49Å; D33-A35 WeakPolarHBondContact OD1-CB 3.5Å; D33-A35 PolarHBondContact OD1-N 2.97Å
36	S	83.1	Confident	71.8	Confident	61 Å²	61	111.6 Å²	111.6	43%	0.427	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.2	-16	177.3	61.9	0	0	0	0	113.9	D33 T38	D33-S36 WeakPolarHBondContact CB-OG 3.44Å; D33-S36 PolarHBondContact O-N 3.13Å; D33-S36 PolarHBondContact O-OG 3.13Å; D33-S36 VanDerWaalsContact OD2-CB 3.29Å; D33-S36 WeakPolarHBondContact OD2-CB 3.26Å; D33-S36 PolarHBondContact OD2-OG 3.35Å; S36-T38 PolarHBondContact O-N 2.97Å; S36-T38 PolarHBondContact OG-OG1 3.42Å
37	G	82.4	Confident	70.6	Confident	39 Å²	39	109.9 Å²	109.9	40%	0.402	61%	0.611	S	S	.	*	T	Hydrogen-bonded Turn	trans	67.9	23.9	-178.6	0	0	0	0	0	113.4	Y32 D33	Y32-G37 VanDerWaalsContact OH-CA 3.26Å; Y32-G37 WeakPolarHBondContact OH-CA 3.43Å; Y32-G37 PolarHBondContact OH-O 3.13Å; D33-G37 WeakPolarHBondContact O-CA 3.43Å; D33-G37 PolarHBondContact O-N 3.29Å
38	T	77.5	Confident	69	Low	82 Å²	82	112.2 Å²	112.2	50%	0.503	63%	0.625	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-134.6	150.4	-175.1	63	0	0	0	0	111.6	D33 S36	D33-T38 PolarHBondContact N-O 3.08Å; D33-T38 VanDerWaalsContact N-O 3.11Å; S36-T38 PolarHBondContact O-N 2.97Å; S36-T38 PolarHBondContact OG-OG1 3.42Å
39	M	75.6	Confident	67.6	Low	91 Å²	91	115 Å²	115	45%	0.448	65%	0.648	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-71.3	129.4	168.8	-81.6	172	64.3	0	0	110	D28 Y32 K41	D28-M39 HydrophobicContact CB-CE 3.53Å; D28-M39 HydrophobicContact CB-SD 4.02Å; D28-M39 WeakPolarHBondContact OD1-CE 3.45Å; Y32-M39 HydrophobicContact CD2-CG 4.2Å; M39-K41 PolarHBondContact O-N 3.1Å; M39-K41 VanDerWaalsContact O-N 3.1Å
40	R	72.7	Confident	65.8	Low	182 Å²	182	116.8 Å²	116.8	69%	0.687	66%	0.655	S	S	*	*			trans	-65.1	112.4	170.2	-66.2	179.2	70.4	161.9	2	108.1	N31 D33 S42	N31-R40 WeakPolarHBondContact O-CB 3.38Å; N31-R40 WeakPolarHBondContact O-CG 3.33Å; N31-R40 PolarHBondContact O-N 2.82Å; D33-R40 HydrophobicContact CB-CG 4.43Å; R40-S42 PolarHBondContact O-N 2.69Å; R40-S42 VanDerWaalsContact O-N 3.17Å
41	K	67	Low	64.1	Low	197 Å²	197	117.9 Å²	117.9	86%	0.857	65%	0.653	S	S	*	*			trans	-60.3	120.9	172.7	-71	-174.4	174.4	-176.9	0	108.3	M39 Q43	M39-K41 PolarHBondContact O-N 3.1Å; M39-K41 VanDerWaalsContact O-N 3.1Å; K41-Q43 PolarHBondContact O-N 3.41Å
42	S	63.7	Low	62.4	Low	95 Å²	95	123.5 Å²	123.5	66%	0.664	68%	0.675	S	S	*	*			trans	-57.7	111.5	170.4	53.6	0	0	0	0	107.2	R40 V44	R40-S42 PolarHBondContact O-N 2.69Å; R40-S42 VanDerWaalsContact O-N 3.17Å; S42-V44 PolarHBondContact O-N 3.18Å
43	Q	57.4	Low	60.5	Low	189 Å²	189	126.1 Å²	126.1	88%	0.883	69%	0.691	S	S	*	*			trans	-71.4	75.3	165.9	-74.5	-173.2	-23.8	0	0	106.5	K41 R45	K41-Q43 PolarHBondContact O-N 3.41Å; Q43-R45 PolarHBondContact O-N 2.87Å
44	V	50.2	Low	58.9	Low	121 Å²	121	128 Å²	128	73%	0.733	70%	0.704	S	S	*	*			trans	-65.7	84.8	155.5	175.6	0	0	0	0	104.8	S42 S46	S42-V44 PolarHBondContact O-N 3.18Å; V44-S46 PolarHBondContact O-N 3.29Å; V44-S46 VanDerWaalsContact O-N 3.15Å
45	R	44.3	Very low	57.6	Low	215 Å²	215	128 Å²	128	81%	0.811	70%	0.699	S	S	*	*			trans	-45.1	120.8	157.2	-113.2	-179.1	164.4	-159.2	-3.2	105.8	Q43 G47	Q43-R45 PolarHBondContact O-N 2.87Å; R45-G47 PolarHBondContact O-N 3.11Å
46	S	45.7	Very low	56.1	Low	128 Å²	128	128.3 Å²	128.3	90%	0.895	69%	0.693	S	S	*	*	S	Bend	trans	-47.5	115.5	162	-49.6	0	0	0	0	108.1	V44	V44-S46 PolarHBondContact O-N 3.29Å; V44-S46 VanDerWaalsContact O-N 3.15Å
47	G	45.5	Very low	54.8	Low	63 Å²	63	130.4 Å²	130.4	65%	0.649	70%	0.7	S	S	*	*			trans	102	75.8	178.2	0	0	0	0	0	114.1	R45	R45-G47 PolarHBondContact O-N 3.11Å
48	T	38.6	Very low	53.7	Low	123 Å²	123	133.3 Å²	133.3	76%	0.755	71%	0.714	S	S	*	*				-170.6	122.1	102.8	23	0	0	0	0	107.2	E50	T48-E50 PolarHBondContact O-N 3.29Å
49	S	46.4	Very low	53.1	Low	102 Å²	102	132.1 Å²	132.1	71%	0.713	71%	0.709	S	S	*	*			trans	-61.8	81.7	165.6	164.2	0	0	0	0	108.3	K51	S49-K51 PolarHBondContact O-N 3.31Å
50	E	40.9	Very low	52.6	Low	179 Å²	179	133.3 Å²	133.3	84%	0.836	71%	0.713	S	S	*	*			trans	-71.6	87.3	157.3	-75.9	-173.1	131.6	0	0	106.2	T48 K52	T48-E50 PolarHBondContact O-N 3.29Å; E50-K52 PolarHBondContact O-N 2.98Å
51	K	43.9	Very low	52.6	Low	170 Å²	170	127.6 Å²	127.6	74%	0.739	71%	0.705	S	S	*	*			trans	-55	96.3	154	-67.5	177.1	179.2	177.6	0	104.6	S49 E53	S49-K51 PolarHBondContact O-N 3.31Å; K51-E53 PolarHBondContact O-N 3.46Å
52	K	42.3	Very low	52.9	Low	185 Å²	185	124.4 Å²	124.4	80%	0.804	69%	0.693	S	S	*	*			trans	-60.8	94.8	158.6	-169.9	173.8	-176.3	179.8	0	103.6	E50 V54	E50-K52 PolarHBondContact O-N 2.98Å; K52-V54 HydrophobicContact CG-CG2 4.48Å; K52-V54 PolarHBondContact O-N 2.95Å
53	E	43.7	Very low	53.6	Low	176 Å²	176	126.4 Å²	126.4	82%	0.822	69%	0.692	S	S	*	*			trans	-60.2	91	163.2	-69.7	-158.7	168.9	0	0	105.2	K51 S55	K51-E53 PolarHBondContact O-N 3.46Å; E53-S55 PolarHBondContact O-N 3.35Å
54	V	47.8	Very low	55	Low	102 Å²	102	122.8 Å²	122.8	62%	0.618	68%	0.678	S	S	*	*			trans	-63.6	98.6	154.3	174.4	0	0	0	0	102.8	K52 P56	K52-V54 HydrophobicContact CG-CG2 4.48Å; K52-V54 PolarHBondContact O-N 2.95Å; V54-P56 VanDerWaalsContact O-CD 3.31Å; V54-P56 WeakPolarHBondContact O-CD 3.29Å; V54-P56 VanDerWaalsContact O-N 3.09Å
55	S	55.7	Low	56.7	Low	88 Å²	88	119.9 Å²	119.9	62%	0.615	66%	0.663	S	S	*	*			trans	-47.1	117.4	161.6	177.6	0	0	0	0	105.8	E53 D57	E53-S55 PolarHBondContact O-N 3.35Å; S55-D57 VanDerWaalsContact C-N 3.25Å; S55-D57 PolarHBondContact O-N 3.02Å
56	P	54	Low	58.9	Low	107 Å²	107	114.2 Å²	114.2	70%	0.695	65%	0.649	S	S	*	*			trans	-65.9	97.8	173.9	25.9	-29.2	0	0	0	105.6	V54 S58	V54-P56 VanDerWaalsContact O-CD 3.31Å; V54-P56 WeakPolarHBondContact O-CD 3.29Å; V54-P56 VanDerWaalsContact O-N 3.09Å; P56-S58 PolarHBondContact O-N 3.36Å
57	D	55.2	Low	61.1	Low	105 Å²	105	112.1 Å²	112.1	56%	0.561	63%	0.633	S	S	*	*			trans	-58.1	117.2	169.9	-105.7	-12.4	0	0	0	105.5	S55 S59 E60	S55-D57 VanDerWaalsContact C-N 3.25Å; S55-D57 PolarHBondContact O-N 3.02Å; D57-S59 PolarHBondContact O-N 2.78Å; D57-E60 PolarHBondContact O-N 2.9Å
58	S	60.5	Low	63.3	Low	99 Å²	99	114.7 Å²	114.7	69%	0.692	63%	0.632	S	S	*	*	H	α-helix	trans	-56.2	-18.9	-171.6	52	0	0	0	0	113.2	P56 E62	P56-S58 PolarHBondContact O-N 3.36Å; S58-E62 PolarHBondContact O-N 2.81Å
59	S	63.3	Low	66	Low	58 Å²	58	115.4 Å²	115.4	41%	0.406	63%	0.626	S	S	.	*	H	α-helix	trans	-69.3	-35.9	175.2	66.4	0	0	0	0	113.2	D57 A61 E62 E63	D57-S59 PolarHBondContact O-N 2.78Å; S59-A61 VanDerWaalsContact C-N 3.33Å; S59-A61 PolarHBondContact O-N 2.73Å; S59-E62 PolarHBondContact O-N 3.47Å; S59-E63 WeakPolarHBondContact O-CG 3.26Å; S59-E63 PolarHBondContact O-N 2.97Å
60	E	65.6	Low	68.3	Low	116 Å²	116	119.4 Å²	119.4	54%	0.542	63%	0.625	S	S	.	*	H	α-helix	trans	-67.6	-38.1	-179.9	-63.9	-171.9	159.1	0	0	111	D57 L64	D57-E60 PolarHBondContact O-N 2.9Å; E60-L64 WeakPolarHBondContact O-CB 3.44Å; E60-L64 WeakPolarHBondContact O-CG 3.46Å; E60-L64 PolarHBondContact O-N 2.9Å
61	A	72.8	Confident	70.9	Confident	61 Å²	61	116 Å²	116	50%	0.504	61%	0.612	S	S	.	*	H	α-helix	trans	-67.2	-36.1	175.8	0	0	0	0	0	112.4	S59 S65	S59-A61 VanDerWaalsContact C-N 3.33Å; S59-A61 PolarHBondContact O-N 2.73Å; A61-S65 WeakPolarHBondContact O-CB 3.18Å; A61-S65 PolarHBondContact O-N 3.5Å
62	E	74.1	Confident	73.3	Confident	131 Å²	131	113.3 Å²	113.3	61%	0.612	61%	0.606	S	S	*	*	H	α-helix	trans	-68.8	-47	176.5	-171.6	171.6	-175.8	0	0	111.2	S58 S59 L64 S65 D66	S58-E62 PolarHBondContact O-N 2.81Å; S59-E62 PolarHBondContact O-N 3.47Å; E62-L64 VanDerWaalsContact C-N 3.34Å; E62-L64 PolarHBondContact O-N 3.4Å; E62-S65 WeakPolarHBondContact O-CB 3.4Å; E62-S65 PolarHBondContact O-N 3.01Å; E62-S65 VanDerWaalsContact O-N 3.11Å; E62-S65 PolarHBondContact O-OG 2.93Å; E62-D66 PolarHBondContact O-N 2.95Å
63	E	77.9	Confident	75.9	Confident	136 Å²	136	107.4 Å²	107.4	64%	0.636	59%	0.588	S	S	*	*	H	α-helix	trans	-61.1	-40.5	176.1	-72.6	-177.9	-170.9	0	0	112.4	S59 S65 D66 C67	S59-E63 WeakPolarHBondContact O-CG 3.26Å; S59-E63 PolarHBondContact O-N 2.97Å; E63-S65 VanDerWaalsContact C-N 3.33Å; E63-D66 PolarHBondContact O-N 3.27Å; E63-C67 PolarHBondContact O-N 2.79Å
64	L	86.4	Confident	78.3	Confident	113 Å²	113	104.1 Å²	104.1	59%	0.592	58%	0.575	S	S	*	*	H	α-helix	trans	-63.9	-39.2	174.4	-74.3	172.7	0	0	0	111.9	E60 E62 C67 L68	E60-L64 WeakPolarHBondContact O-CB 3.44Å; E60-L64 WeakPolarHBondContact O-CG 3.46Å; E60-L64 PolarHBondContact O-N 2.9Å; E62-L64 VanDerWaalsContact C-N 3.34Å; E62-L64 PolarHBondContact O-N 3.4Å; L64-C67 PolarHBondContact O-N 3.3Å; L64-L68 VanDerWaalsContact O-CG 3.31Å; L64-L68 WeakPolarHBondContact O-CG 3.18Å; L64-L68 PolarHBondContact O-N 2.95Å
65	S	86.7	Confident	80.6	Confident	60 Å²	60	102.3 Å²	102.3	42%	0.42	57%	0.565	S	S	.	*	H	α-helix	trans	-65.1	-40.4	178.8	77.9	0	0	0	0	112.5	A61 E62 E63 L68 H69	A61-S65 WeakPolarHBondContact O-CB 3.18Å; A61-S65 PolarHBondContact O-N 3.5Å; E62-S65 WeakPolarHBondContact O-CB 3.4Å; E62-S65 PolarHBondContact O-N 3.01Å; E62-S65 VanDerWaalsContact O-N 3.11Å; E62-S65 PolarHBondContact O-OG 2.93Å; E63-S65 VanDerWaalsContact C-N 3.33Å; S65-L68 PolarHBondContact O-N 3.17Å; S65-H69 PolarHBondContact O-N 3.34Å
66	D	89.8	Confident	82.4	Confident	96 Å²	96	104.5 Å²	104.5	51%	0.513	57%	0.565	S	S	.	*	H	α-helix	trans	-65.2	-40.5	175.3	-94.3	4.9	0	0	0	111.9	E62 E63 H69 R70	E62-D66 PolarHBondContact O-N 2.95Å; E63-D66 PolarHBondContact O-N 3.27Å; D66-H69 PolarHBondContact O-N 2.95Å; D66-R70 VanDerWaalsContact O-CG 3.32Å; D66-R70 WeakPolarHBondContact O-CG 3.47Å; D66-R70 PolarHBondContact O-N 3.15Å
67	C	92.1	Very high	84.3	Confident	84 Å²	84	105.7 Å²	105.7	57%	0.568	56%	0.559	S	S	*	*	H	α-helix	trans	-62.1	-45.6	174.4	-103.1	0	0	0	0	112	E63 L64 R70 L71	E63-C67 PolarHBondContact O-N 2.79Å; L64-C67 PolarHBondContact O-N 3.3Å; C67-R70 PolarHBondContact O-N 2.97Å; C67-L71 WeakPolarHBondContact O-CB 3.35Å; C67-L71 PolarHBondContact O-N 2.99Å
68	L	92.1	Very high	86.2	Confident	118 Å²	118	104 Å²	104	62%	0.618	55%	0.553	S	S	*	*	H	α-helix	trans	-62.8	-42.7	177.9	-72	172.6	0	0	0	111.7	L64 S65 R70 L71 D72	L64-L68 VanDerWaalsContact O-CG 3.31Å; L64-L68 WeakPolarHBondContact O-CG 3.18Å; L64-L68 PolarHBondContact O-N 2.95Å; S65-L68 PolarHBondContact O-N 3.17Å; L68-R70 VanDerWaalsContact C-N 3.35Å; L68-R70 PolarHBondContact O-N 3.43Å; L68-L71 PolarHBondContact O-N 3.08Å; L68-D72 PolarHBondContact O-N 3.46Å
69	H	94.7	Very high	87.7	Confident	137 Å²	137	102.4 Å²	102.4	63%	0.634	54%	0.536	S	S	*	.	H	α-helix	trans	-63	-40.6	176.9	-179.6	-92.3	0	0	0	112.2	S65 D66 D72 S73	S65-H69 PolarHBondContact O-N 3.34Å; D66-H69 PolarHBondContact O-N 2.95Å; H69-D72 PolarHBondContact O-N 3.24Å; H69-S73 WeakPolarHBondContact O-CB 3.35Å; H69-S73 PolarHBondContact O-N 3.35Å
70	R	95.4	Very high	89	Confident	187 Å²	187	102.7 Å²	102.7	71%	0.706	54%	0.538	S	S	*	.	H	α-helix	trans	-64.3	-40	174.9	-74.1	176	175	-160.6	1.1	112.2	D66 C67 L68 S73 L74	D66-R70 VanDerWaalsContact O-CG 3.32Å; D66-R70 WeakPolarHBondContact O-CG 3.47Å; D66-R70 PolarHBondContact O-N 3.15Å; C67-R70 PolarHBondContact O-N 2.97Å; L68-R70 VanDerWaalsContact C-N 3.35Å; L68-R70 PolarHBondContact O-N 3.43Å; R70-S73 PolarHBondContact O-N 3.31Å; R70-L74 WeakPolarHBondContact O-CB 3.39Å; R70-L74 PolarHBondContact O-N 3.07Å
71	L	95.9	Very high	89.9	Confident	106 Å²	106	101.5 Å²	101.5	56%	0.555	54%	0.542	S	S	*	.	H	α-helix	trans	-65.2	-42.9	178	-172.7	146.6	0	0	0	111.4	C67 L68 L74 T75	C67-L71 WeakPolarHBondContact O-CB 3.35Å; C67-L71 PolarHBondContact O-N 2.99Å; L68-L71 PolarHBondContact O-N 3.08Å; L71-L74 PolarHBondContact O-N 3.04Å; L71-T75 WeakPolarHBondContact O-CB 3.32Å; L71-T75 PolarHBondContact O-N 3.02Å; L71-T75 PolarHBondContact O-OG1 2.67Å
72	D	94.1	Very high	90.3	Very high	114 Å²	114	105.8 Å²	105.8	61%	0.61	55%	0.551	S	S	*	*	H	α-helix	trans	-65.6	-43.3	178	-158	36.3	0	0	0	111.3	L68 H69 L74 T75 H76	L68-D72 PolarHBondContact O-N 3.46Å; H69-D72 PolarHBondContact O-N 3.24Å; D72-L74 VanDerWaalsContact C-N 3.33Å; D72-L74 PolarHBondContact O-N 3.01Å; D72-T75 PolarHBondContact O-N 3.4Å; D72-H76 WeakPolarHBondContact O-CB 3.35Å; D72-H76 PolarHBondContact O-N 3.45Å
73	S	95.9	Very high	90.4	Very high	61 Å²	61	107.4 Å²	107.4	43%	0.427	56%	0.556	S	S	.	*	H	α-helix	trans	-59.8	-41.7	173.4	-172	0	0	0	0	112.7	H69 R70 K77	H69-S73 WeakPolarHBondContact O-CB 3.35Å; H69-S73 PolarHBondContact O-N 3.35Å; R70-S73 PolarHBondContact O-N 3.31Å; S73-K77 WeakPolarHBondContact O-CG 3.46Å; S73-K77 PolarHBondContact O-N 2.95Å; S73-K77 VanDerWaalsContact O-N 3.13Å
74	L	94.8	Very high	89.4	Confident	107 Å²	107	112.2 Å²	112.2	56%	0.56	58%	0.575	S	S	*	*	H	α-helix	trans	-65.9	-44.7	177.1	-177.4	61.8	0	0	0	111.4	R70 L71 D72 H76 K77 V78	R70-L74 WeakPolarHBondContact O-CB 3.39Å; R70-L74 PolarHBondContact O-N 3.07Å; L71-L74 PolarHBondContact O-N 3.04Å; D72-L74 VanDerWaalsContact C-N 3.33Å; D72-L74 PolarHBondContact O-N 3.01Å; L74-H76 PolarHBondContact O-N 2.77Å; L74-K77 WeakPolarHBondContact O-CB 3.31Å; L74-K77 PolarHBondContact O-N 3.07Å; L74-K77 VanDerWaalsContact O-N 3.13Å; L74-V78 WeakPolarHBondContact O-CG2 3.45Å; L74-V78 PolarHBondContact O-N 3.11Å
75	T	95.2	Very high	89.5	Confident	64 Å²	64	112.2 Å²	112.2	39%	0.393	57%	0.574	S	S	.	*	H	α-helix	trans	-60.1	-47.1	178.9	-56.5	0	0	0	0	110.6	L71 D72 K77 V78 D79	L71-T75 WeakPolarHBondContact O-CB 3.32Å; L71-T75 PolarHBondContact O-N 3.02Å; L71-T75 PolarHBondContact O-OG1 2.67Å; D72-T75 PolarHBondContact O-N 3.4Å; T75-K77 VanDerWaalsContact C-N 3.28Å; T75-K77 PolarHBondContact O-N 3.06Å; T75-V78 PolarHBondContact O-N 2.93Å; T75-V78 VanDerWaalsContact O-N 3.13Å; T75-D79 PolarHBondContact O-N 3Å
76	H	94	Very high	89.7	Confident	135 Å²	135	114.9 Å²	114.9	63%	0.625	58%	0.583	S	S	*	*	H	α-helix	trans	-59.7	-37.1	175.5	-177.8	-85.9	0	0	0	112.9	D72 L74 S80	D72-H76 WeakPolarHBondContact O-CB 3.35Å; D72-H76 PolarHBondContact O-N 3.45Å; L74-H76 PolarHBondContact O-N 2.77Å; H76-S80 WeakPolarHBondContact O-CB 3.42Å; H76-S80 PolarHBondContact O-N 3.46Å; H76-S80 VanDerWaalsContact O-N 3.08Å
77	K	94.4	Very high	89.7	Confident	132 Å²	132	116 Å²	116	57%	0.574	59%	0.586	S	S	*	*	H	α-helix	trans	-68.3	-39.2	175.8	-74.6	174.5	64.7	179.5	0	112.3	S73 L74 T75 S80 C81	S73-K77 WeakPolarHBondContact O-CG 3.46Å; S73-K77 PolarHBondContact O-N 2.95Å; S73-K77 VanDerWaalsContact O-N 3.13Å; L74-K77 WeakPolarHBondContact O-CB 3.31Å; L74-K77 PolarHBondContact O-N 3.07Å; L74-K77 VanDerWaalsContact O-N 3.13Å; T75-K77 VanDerWaalsContact C-N 3.28Å; T75-K77 PolarHBondContact O-N 3.06Å; K77-S80 PolarHBondContact O-N 2.83Å; K77-C81 PolarHBondContact O-N 2.82Å; K77-C81 VanDerWaalsContact O-N 3.1Å; K77-C81 PolarHBondContact O-SG 2.81Å; K77-C81 VanDerWaalsContact O-SG 3.35Å
78	V	94.8	Very high	89.5	Confident	70 Å²	70	117.9 Å²	117.9	42%	0.424	59%	0.587	S	S	.	*	H	α-helix	trans	-63.2	-49.6	176.2	171.9	0	0	0	0	110	L74 T75 S80 C81 E82	L74-V78 WeakPolarHBondContact O-CG2 3.45Å; L74-V78 PolarHBondContact O-N 3.11Å; T75-V78 PolarHBondContact O-N 2.93Å; T75-V78 VanDerWaalsContact O-N 3.13Å; V78-S80 VanDerWaalsContact C-N 3.26Å; V78-S80 PolarHBondContact O-N 2.83Å; V78-C81 WeakPolarHBondContact O-CA 3.2Å; V78-C81 WeakPolarHBondContact O-CB 3.38Å; V78-C81 PolarHBondContact O-N 2.77Å; V78-E82 HydrophobicContact CG1-CG 4.5Å; V78-E82 PolarHBondContact O-N 2.95Å
79	D	92.3	Very high	89.4	Confident	64 Å²	64	117.9 Å²	117.9	34%	0.342	59%	0.586	S	S	.	*	H	α-helix	trans	-56.2	-40.1	176.4	-86.3	23.9	0	0	0	112.8	T75 C81 E82 K83	T75-D79 PolarHBondContact O-N 3Å; D79-C81 VanDerWaalsContact C-N 3.32Å; D79-E82 PolarHBondContact O-N 2.92Å; D79-K83 WeakPolarHBondContact O-CB 3.49Å; D79-K83 WeakPolarHBondContact O-CD 3.31Å; D79-K83 WeakPolarHBondContact O-CG 3.4Å; D79-K83 PolarHBondContact O-N 3.29Å; D79-K83 VanDerWaalsContact O-N 3.13Å; D79-K83 IonicContact OD2-NZ 3.75Å
80	S	89.8	Confident	89	Confident	64 Å²	64	116.6 Å²	116.6	45%	0.448	58%	0.582	S	S	.	*	H	α-helix	trans	-68.2	-32.5	178	-173.2	0	0	0	0	112.6	H76 K77 V78	H76-S80 WeakPolarHBondContact O-CB 3.42Å; H76-S80 PolarHBondContact O-N 3.46Å; H76-S80 VanDerWaalsContact O-N 3.08Å; K77-S80 PolarHBondContact O-N 2.83Å; V78-S80 VanDerWaalsContact C-N 3.26Å; V78-S80 PolarHBondContact O-N 2.83Å
81	C	83.6	Confident	88.6	Confident	91 Å²	91	111.6 Å²	111.6	62%	0.615	57%	0.574	S	S	*	*	H	α-helix	trans	-74.7	-38.2	174	-72.4	0	0	0	0	112.3	K77 V78 D79 K83 K84	K77-C81 PolarHBondContact O-N 2.82Å; K77-C81 VanDerWaalsContact O-N 3.1Å; K77-C81 PolarHBondContact O-SG 2.81Å; K77-C81 VanDerWaalsContact O-SG 3.35Å; V78-C81 WeakPolarHBondContact O-CA 3.2Å; V78-C81 WeakPolarHBondContact O-CB 3.38Å; V78-C81 PolarHBondContact O-N 2.77Å; D79-C81 VanDerWaalsContact C-N 3.32Å; C81-K83 VanDerWaalsContact C-N 3.3Å; C81-K83 PolarHBondContact O-N 3.48Å; C81-K84 PolarHBondContact O-N 3.03Å
82	E	81.9	Confident	88	Confident	151 Å²	151	112 Å²	112	71%	0.706	58%	0.575	S	S	*	*	H	α-helix	trans	-69.3	-27.8	177.2	-72.5	-170.1	160.7	0	0	113.1	V78 D79 K84	V78-E82 HydrophobicContact CG1-CG 4.5Å; V78-E82 PolarHBondContact O-N 2.95Å; D79-E82 PolarHBondContact O-N 2.92Å; E82-K84 VanDerWaalsContact C-N 3.27Å; E82-K84 PolarHBondContact O-N 3.3Å
83	K	77.4	Confident	87.5	Confident	165 Å²	165	111.8 Å²	111.8	72%	0.717	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-0.8	178.3	-70.4	167.7	-172.1	162.1	0	113.8	D79 C81	D79-K83 WeakPolarHBondContact O-CB 3.49Å; D79-K83 WeakPolarHBondContact O-CD 3.31Å; D79-K83 WeakPolarHBondContact O-CG 3.4Å; D79-K83 PolarHBondContact O-N 3.29Å; D79-K83 VanDerWaalsContact O-N 3.13Å; D79-K83 IonicContact OD2-NZ 3.75Å; C81-K83 VanDerWaalsContact C-N 3.3Å; C81-K83 PolarHBondContact O-N 3.48Å
84	K	55.8	Low	86.7	Confident	238 Å²	238	116.5 Å²	116.5	100%	1.035	59%	0.585	S	S	*	*			trans	-104.5	0	177	-89.8	-175.6	164.8	-168.5	0	111.4	C81 E82	C81-K84 PolarHBondContact O-N 3.03Å; E82-K84 VanDerWaalsContact C-N 3.27Å; E82-K84 PolarHBondContact O-N 3.3Å

Retrieved 84 of 84 residues in 31.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).