Z4YMI1_MOUSE Loading...

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6

AlphaFold DB , UniProt , Accession Z4YMI1, Species MOUSE (Mus musculus, Mouse), Gene St6galnac6, Length 108 aa.

						>Z4YMI1_MOUSE|Z4YMI1|St6galnac6
MSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRTRRPVNLKKWSFSSAYFPILGNKTLPSRCNQCVIITSSSHLLGTKLGPEIERAECTIRMNDAPTSG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.1	Low	72.9	Confident	214 Å²	214	116.3 Å²	116.3	100%	1.054	61%	0.611	S	S	*	*				0	-7.1	0	-137.5	106.8	80.6	0	0	114.9
2	S	57.4	Low	74.6	Confident	78 Å²	78	117.9 Å²	117.9	55%	0.545	61%	0.61	S	S	.	*			trans	-83.6	-45.5	-178.1	-154.4	0	0	0	0	113.3	N4 K5 E6	S2-N4 VanDerWaalsContact C-N 3.33Å; S2-N4 PolarHBondContact O-N 3.29Å; S2-K5 PolarHBondContact O-N 3.48Å; S2-E6 PolarHBondContact O-N 3.27Å
3	S	61.3	Low	76.1	Confident	76 Å²	76	116.2 Å²	116.2	53%	0.531	61%	0.608	S	S	.	*	H	α-helix	trans	-57.5	-36.9	-175.3	171.6	0	0	0	0	114.6	K5 E6 Q7	S3-K5 VanDerWaalsContact C-N 3.33Å; S3-K5 PolarHBondContact O-N 3.21Å; S3-E6 PolarHBondContact O-N 3.03Å; S3-Q7 WeakPolarHBondContact O-CG 3.44Å; S3-Q7 PolarHBondContact O-N 3.22Å
4	N	65.8	Low	77.6	Confident	114 Å²	114	115.2 Å²	115.2	61%	0.61	60%	0.602	S	S	*	*	H	α-helix	trans	-68.5	-29.2	178	-103.1	-89.4	0	0	0	113.3	S2 R8	S2-N4 VanDerWaalsContact C-N 3.33Å; S2-N4 PolarHBondContact O-N 3.29Å; N4-R8 VanDerWaalsContact O-CG 3.28Å; N4-R8 WeakPolarHBondContact O-CG 3.28Å; N4-R8 PolarHBondContact O-N 2.98Å
5	K	69.4	Low	78.8	Confident	160 Å²	160	113.6 Å²	113.6	70%	0.696	59%	0.593	S	S	*	*	H	α-helix	trans	-76.5	-40.1	177.7	-70.8	-178	176.7	-180	0	111	S2 S3 R8 S9	S2-K5 PolarHBondContact O-N 3.48Å; S3-K5 VanDerWaalsContact C-N 3.33Å; S3-K5 PolarHBondContact O-N 3.21Å; K5-R8 PolarHBondContact O-N 3.44Å; K5-S9 WeakPolarHBondContact O-CB 3.03Å; K5-S9 PolarHBondContact O-N 2.88Å
6	E	74.2	Confident	79.8	Confident	128 Å²	128	115.8 Å²	115.8	60%	0.598	60%	0.597	S	S	*	*	H	α-helix	trans	-65.6	-43.2	175.7	-71.6	170.8	-171.5	0	0	111.9	S2 S3 R8 S9 A10	S2-E6 PolarHBondContact O-N 3.27Å; S3-E6 PolarHBondContact O-N 3.03Å; E6-R8 PolarHBondContact O-N 3.33Å; E6-S9 PolarHBondContact O-N 3.45Å; E6-A10 WeakPolarHBondContact O-CB 3.48Å; E6-A10 PolarHBondContact O-N 3.28Å
7	Q	76.1	Confident	80.8	Confident	125 Å²	125	111.6 Å²	111.6	58%	0.584	58%	0.583	S	S	*	*	H	α-helix	trans	-60.4	-44.7	174.5	-78.9	-166.7	-41.5	0	0	112.3	S3 S9 A10 V11	S3-Q7 WeakPolarHBondContact O-CG 3.44Å; S3-Q7 PolarHBondContact O-N 3.22Å; Q7-S9 VanDerWaalsContact C-N 3.35Å; Q7-S9 PolarHBondContact O-N 3.42Å; Q7-A10 PolarHBondContact O-N 3.36Å; Q7-V11 VanDerWaalsContact O-CG2 3.29Å; Q7-V11 WeakPolarHBondContact O-CG2 3.24Å; Q7-V11 PolarHBondContact O-N 3.46Å
8	R	80.4	Confident	81.7	Confident	173 Å²	173	111.3 Å²	111.3	65%	0.653	58%	0.582	S	S	*	*	H	α-helix	trans	-64	-41.1	177.4	-71.9	174.8	80.2	178.2	5.1	111.6	N4 K5 E6 V11 F12	N4-R8 VanDerWaalsContact O-CG 3.28Å; N4-R8 WeakPolarHBondContact O-CG 3.28Å; N4-R8 PolarHBondContact O-N 2.98Å; K5-R8 PolarHBondContact O-N 3.44Å; E6-R8 PolarHBondContact O-N 3.33Å; R8-V11 PolarHBondContact O-N 3.01Å; R8-F12 WeakPolarHBondContact O-CD2 3.43Å; R8-F12 PolarHBondContact O-N 3Å
9	S	85.2	Confident	82.4	Confident	71 Å²	71	109.8 Å²	109.8	50%	0.497	57%	0.574	S	S	.	*	H	α-helix	trans	-60.8	-46.3	175	-170.5	0	0	0	0	111.8	K5 E6 Q7 V11 F12 V13	K5-S9 WeakPolarHBondContact O-CB 3.03Å; K5-S9 PolarHBondContact O-N 2.88Å; E6-S9 PolarHBondContact O-N 3.45Å; Q7-S9 VanDerWaalsContact C-N 3.35Å; Q7-S9 PolarHBondContact O-N 3.42Å; S9-V11 VanDerWaalsContact C-N 3.32Å; S9-V11 PolarHBondContact O-N 3.09Å; S9-F12 PolarHBondContact O-N 2.92Å; S9-V13 WeakPolarHBondContact O-CG2 3.46Å; S9-V13 PolarHBondContact O-N 2.94Å; S9-V13 VanDerWaalsContact O-N 3.09Å
10	A	89.3	Confident	83	Confident	47 Å²	47	107 Å²	107	39%	0.388	56%	0.561	S	S	.	*	H	α-helix	trans	-60.5	-40	177.6	0	0	0	0	0	112.3	E6 Q7 F12 V13 I14	E6-A10 WeakPolarHBondContact O-CB 3.48Å; E6-A10 PolarHBondContact O-N 3.28Å; Q7-A10 PolarHBondContact O-N 3.36Å; A10-F12 PolarHBondContact O-N 3.45Å; A10-V13 PolarHBondContact O-N 3.33Å; A10-I14 WeakPolarHBondContact O-CB 3.48Å; A10-I14 WeakPolarHBondContact O-CD1 3.5Å; A10-I14 VanDerWaalsContact O-CG1 3.24Å; A10-I14 WeakPolarHBondContact O-CG1 3.29Å; A10-I14 PolarHBondContact O-N 3.32Å
11	V	92.6	Very high	83.5	Confident	93 Å²	93	107 Å²	107	56%	0.564	56%	0.561	S	S	*	*	H	α-helix	trans	-60.4	-44.3	176.2	171	0	0	0	0	111.5	Q7 R8 S9 I14 L15	Q7-V11 VanDerWaalsContact O-CG2 3.29Å; Q7-V11 WeakPolarHBondContact O-CG2 3.24Å; Q7-V11 PolarHBondContact O-N 3.46Å; R8-V11 PolarHBondContact O-N 3.01Å; S9-V11 VanDerWaalsContact C-N 3.32Å; S9-V11 PolarHBondContact O-N 3.09Å; V11-I14 PolarHBondContact O-N 3.47Å; V11-L15 VanDerWaalsContact O-CB 3.3Å; V11-L15 WeakPolarHBondContact O-CB 3.3Å; V11-L15 PolarHBondContact O-N 3.2Å
12	F	93.3	Very high	85.3	Confident	136 Å²	136	102.3 Å²	102.3	60%	0.596	54%	0.54	S	S	*	.	H	α-helix	trans	-65.7	-39.3	178.2	-73.3	-66	0	0	0	112.6	R8 S9 A10 L15 F16	R8-F12 WeakPolarHBondContact O-CD2 3.43Å; R8-F12 PolarHBondContact O-N 3Å; S9-F12 PolarHBondContact O-N 2.92Å; A10-F12 PolarHBondContact O-N 3.45Å; F12-L15 PolarHBondContact O-N 3.37Å; F12-F16 WeakPolarHBondContact O-CB 3.34Å; F12-F16 PolarHBondContact O-N 3.5Å
13	V	94.8	Very high	86.7	Confident	96 Å²	96	103.1 Å²	103.1	58%	0.582	54%	0.537	S	S	*	.	H	α-helix	trans	-65	-45.1	177.1	174.3	0	0	0	0	111.1	S9 A10 F16 A17	S9-V13 WeakPolarHBondContact O-CG2 3.46Å; S9-V13 PolarHBondContact O-N 2.94Å; S9-V13 VanDerWaalsContact O-N 3.09Å; A10-V13 PolarHBondContact O-N 3.33Å; V13-F16 PolarHBondContact O-N 3.47Å; V13-A17 WeakPolarHBondContact O-CB 3.29Å; V13-A17 PolarHBondContact O-N 2.94Å
14	I	95.9	Very high	87.7	Confident	102 Å²	102	104.9 Å²	104.9	52%	0.523	54%	0.54	S	S	.	.	H	α-helix	trans	-63.2	-45.8	177.5	-67.9	165.4	0	0	0	110.3	A10 V11 F16 A17 L18	A10-I14 WeakPolarHBondContact O-CB 3.48Å; A10-I14 WeakPolarHBondContact O-CD1 3.5Å; A10-I14 VanDerWaalsContact O-CG1 3.24Å; A10-I14 WeakPolarHBondContact O-CG1 3.29Å; A10-I14 PolarHBondContact O-N 3.32Å; V11-I14 PolarHBondContact O-N 3.47Å; I14-F16 PolarHBondContact O-N 3.28Å; I14-A17 PolarHBondContact O-N 3.45Å; I14-L18 HydrophobicContact CG2-CD1 3.91Å; I14-L18 HydrophobicContact CG2-CG 4.31Å; I14-L18 VanDerWaalsContact O-CG 3.3Å; I14-L18 WeakPolarHBondContact O-CG 3.44Å; I14-L18 PolarHBondContact O-N 3.24Å
15	L	95.8	Very high	88.4	Confident	91 Å²	91	107.6 Å²	107.6	48%	0.476	54%	0.543	S	S	.	.	H	α-helix	trans	-60.9	-44.8	179	-175	67	0	0	0	111.5	V11 F12 A17 L18 I19	V11-L15 VanDerWaalsContact O-CB 3.3Å; V11-L15 WeakPolarHBondContact O-CB 3.3Å; V11-L15 PolarHBondContact O-N 3.2Å; F12-L15 PolarHBondContact O-N 3.37Å; L15-A17 PolarHBondContact O-N 3.42Å; L15-L18 PolarHBondContact O-N 3.21Å; L15-I19 HydrophobicContact CD1-CD1 4.24Å; L15-I19 HydrophobicContact CG-CD1 3.92Å; L15-I19 VanDerWaalsContact O-CG1 3.29Å; L15-I19 WeakPolarHBondContact O-CG1 3.43Å; L15-I19 PolarHBondContact O-N 3.15Å
16	F	95.8	Very high	88.4	Confident	148 Å²	148	103.5 Å²	103.5	65%	0.649	53%	0.534	S	S	*	.	H	α-helix	trans	-61.8	-43.3	177	-178.1	-97.5	0	0	0	112	F12 V13 I14 I19 T20	F12-F16 WeakPolarHBondContact O-CB 3.34Å; F12-F16 PolarHBondContact O-N 3.5Å; V13-F16 PolarHBondContact O-N 3.47Å; I14-F16 PolarHBondContact O-N 3.28Å; F16-I19 PolarHBondContact O-N 3.31Å; F16-T20 WeakPolarHBondContact O-CB 3.44Å; F16-T20 PolarHBondContact O-N 3.29Å; F16-T20 PolarHBondContact O-OG1 2.97Å
17	A	96.7	Very high	87.9	Confident	45 Å²	45	101.5 Å²	101.5	37%	0.372	53%	0.534	S	S	.	.	H	α-helix	trans	-61.9	-45.3	176.2	0	0	0	0	0	111.7	V13 I14 L15 T20 I21	V13-A17 WeakPolarHBondContact O-CB 3.29Å; V13-A17 PolarHBondContact O-N 2.94Å; I14-A17 PolarHBondContact O-N 3.45Å; L15-A17 PolarHBondContact O-N 3.42Å; A17-T20 PolarHBondContact O-N 3.47Å; A17-I21 WeakPolarHBondContact O-CB 3.48Å; A17-I21 VanDerWaalsContact O-CG1 3.25Å; A17-I21 WeakPolarHBondContact O-CG1 3.36Å; A17-I21 PolarHBondContact O-N 2.98Å
18	L	96.4	Very high	87	Confident	106 Å²	106	102.4 Å²	102.4	56%	0.555	54%	0.543	S	S	*	.	H	α-helix	trans	-62.9	-44.3	178.4	-70.7	174	0	0	0	112.3	I14 L15 T20 I21 L22	I14-L18 HydrophobicContact CG2-CD1 3.91Å; I14-L18 HydrophobicContact CG2-CG 4.31Å; I14-L18 VanDerWaalsContact O-CG 3.3Å; I14-L18 WeakPolarHBondContact O-CG 3.44Å; I14-L18 PolarHBondContact O-N 3.24Å; L15-L18 PolarHBondContact O-N 3.21Å; L18-T20 VanDerWaalsContact C-N 3.34Å; L18-I21 PolarHBondContact O-N 3.22Å; L18-L22 WeakPolarHBondContact O-CB 3.46Å; L18-L22 PolarHBondContact O-N 2.71Å
19	I	95.4	Very high	85.5	Confident	84 Å²	84	97.8 Å²	97.8	43%	0.431	54%	0.537	S	S	.	.	H	α-helix	trans	-62.9	-43.7	176.7	-67.7	167.4	0	0	0	110.3	L15 F16 L22 I23	L15-I19 HydrophobicContact CD1-CD1 4.24Å; L15-I19 HydrophobicContact CG-CD1 3.92Å; L15-I19 VanDerWaalsContact O-CG1 3.29Å; L15-I19 WeakPolarHBondContact O-CG1 3.43Å; L15-I19 PolarHBondContact O-N 3.15Å; F16-I19 PolarHBondContact O-N 3.31Å; I19-L22 PolarHBondContact O-N 3.42Å; I19-I23 HydrophobicContact CG2-CD1 3.9Å; I19-I23 VanDerWaalsContact O-CG1 3.32Å; I19-I23 WeakPolarHBondContact O-CG1 3.41Å; I19-I23 PolarHBondContact O-N 2.97Å
20	T	94.9	Very high	83.8	Confident	53 Å²	53	98.3 Å²	98.3	33%	0.325	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-44.4	178.9	-53.2	0	0	0	0	111.4	F16 A17 L18 L22 I23 L24	F16-T20 WeakPolarHBondContact O-CB 3.44Å; F16-T20 PolarHBondContact O-N 3.29Å; F16-T20 PolarHBondContact O-OG1 2.97Å; A17-T20 PolarHBondContact O-N 3.47Å; L18-T20 VanDerWaalsContact C-N 3.34Å; T20-L22 VanDerWaalsContact C-N 3.35Å; T20-L22 PolarHBondContact O-N 3.41Å; T20-I23 PolarHBondContact O-N 3.34Å; T20-L24 HydrophobicContact CG2-CD1 4.31Å; T20-L24 WeakPolarHBondContact O-CG 3.28Å; T20-L24 PolarHBondContact O-N 3.11Å
21	I	93.3	Very high	81.8	Confident	107 Å²	107	103 Å²	103	55%	0.549	57%	0.565	S	S	.	*	H	α-helix	trans	-61.7	-42.9	175.9	-70.3	165.6	0	0	0	111	A17 L18 I23 L24 Y25	A17-I21 WeakPolarHBondContact O-CB 3.48Å; A17-I21 VanDerWaalsContact O-CG1 3.25Å; A17-I21 WeakPolarHBondContact O-CG1 3.36Å; A17-I21 PolarHBondContact O-N 2.98Å; L18-I21 PolarHBondContact O-N 3.22Å; I21-I23 PolarHBondContact O-N 2.92Å; I21-L24 PolarHBondContact O-N 2.94Å; I21-Y25 VanDerWaalsContact O-CB 3.31Å; I21-Y25 WeakPolarHBondContact O-CB 3.42Å; I21-Y25 PolarHBondContact O-N 3.14Å
22	L	88.2	Confident	79.5	Confident	116 Å²	116	105.1 Å²	105.1	61%	0.607	57%	0.568	S	S	*	*	H	α-helix	trans	-61.4	-44.7	177.7	-178.2	65.9	0	0	0	111.6	L18 I19 T20 Y25 S26	L18-L22 WeakPolarHBondContact O-CB 3.46Å; L18-L22 PolarHBondContact O-N 2.71Å; I19-L22 PolarHBondContact O-N 3.42Å; T20-L22 VanDerWaalsContact C-N 3.35Å; T20-L22 PolarHBondContact O-N 3.41Å; L22-Y25 PolarHBondContact O-N 3.32Å; L22-S26 WeakPolarHBondContact O-CB 3.32Å; L22-S26 PolarHBondContact O-N 3.32Å; L22-S26 PolarHBondContact O-OG 2.91Å
23	I	85.8	Confident	77.1	Confident	94 Å²	94	103.6 Å²	103.6	48%	0.482	57%	0.57	S	S	.	*	H	α-helix	trans	-60.2	-48.2	176.4	-68	166.3	0	0	0	110	I19 T20 I21 Y25 S26 S27	I19-I23 HydrophobicContact CG2-CD1 3.9Å; I19-I23 VanDerWaalsContact O-CG1 3.32Å; I19-I23 WeakPolarHBondContact O-CG1 3.41Å; I19-I23 PolarHBondContact O-N 2.97Å; T20-I23 PolarHBondContact O-N 3.34Å; I21-I23 PolarHBondContact O-N 2.92Å; I23-Y25 PolarHBondContact O-N 2.72Å; I23-S26 WeakPolarHBondContact CA-OG 3.3Å; I23-S26 PolarHBondContact O-N 2.96Å; I23-S26 PolarHBondContact O-OG 3.18Å; I23-S27 VanDerWaalsContact O-CB 3.25Å; I23-S27 WeakPolarHBondContact O-CB 3.29Å; I23-S27 PolarHBondContact O-N 2.99Å; I23-S27 PolarHBondContact O-OG 3.18Å
24	L	82	Confident	74.7	Confident	114 Å²	114	106.3 Å²	106.3	60%	0.597	57%	0.574	S	S	*	*	H	α-helix	trans	-63.4	-40.2	178.7	-69.1	174.3	0	0	0	112.5	T20 I21 S27 N28	T20-L24 HydrophobicContact CG2-CD1 4.31Å; T20-L24 WeakPolarHBondContact O-CG 3.28Å; T20-L24 PolarHBondContact O-N 3.11Å; I21-L24 PolarHBondContact O-N 2.94Å; L24-S27 PolarHBondContact O-N 3.17Å; L24-N28 WeakPolarHBondContact O-CB 3.12Å; L24-N28 PolarHBondContact O-N 2.93Å; L24-N28 VanDerWaalsContact O-N 3.16Å
25	Y	81.1	Confident	71.9	Confident	171 Å²	171	109.5 Å²	109.5	67%	0.671	59%	0.586	S	S	*	*	H	α-helix	trans	-66.2	-47.7	177.2	-177.2	-100.7	0	0	0	111.9	I21 L22 I23 S27 N28 S29	I21-Y25 VanDerWaalsContact O-CB 3.31Å; I21-Y25 WeakPolarHBondContact O-CB 3.42Å; I21-Y25 PolarHBondContact O-N 3.14Å; L22-Y25 PolarHBondContact O-N 3.32Å; I23-Y25 PolarHBondContact O-N 2.72Å; Y25-S27 PolarHBondContact O-N 3.28Å; Y25-N28 PolarHBondContact O-N 3.49Å; Y25-N28 VanDerWaalsContact O-N 3.1Å; Y25-S29 PolarHBondContact O-N 3.17Å
26	S	69	Low	69.2	Low	73 Å²	73	116.1 Å²	116.1	51%	0.51	61%	0.607	S	S	.	*	H	α-helix	trans	-64.3	-28.1	176.6	66.1	0	0	0	0	112.8	L22 I23 N28	L22-S26 WeakPolarHBondContact O-CB 3.32Å; L22-S26 PolarHBondContact O-N 3.32Å; L22-S26 PolarHBondContact O-OG 2.91Å; I23-S26 WeakPolarHBondContact CA-OG 3.3Å; I23-S26 PolarHBondContact O-N 2.96Å; I23-S26 PolarHBondContact O-OG 3.18Å; S26-N28 VanDerWaalsContact C-N 3.34Å
27	S	63.5	Low	66.5	Low	87 Å²	87	112 Å²	112	61%	0.608	61%	0.606	S	S	*	*	H	α-helix	trans	-78.9	-18.5	176.6	-59.4	0	0	0	0	112.7	I23 L24 Y25	I23-S27 VanDerWaalsContact O-CB 3.25Å; I23-S27 WeakPolarHBondContact O-CB 3.29Å; I23-S27 PolarHBondContact O-N 2.99Å; I23-S27 PolarHBondContact O-OG 3.18Å; L24-S27 PolarHBondContact O-N 3.17Å; Y25-S27 PolarHBondContact O-N 3.28Å
28	N	58.2	Low	64.1	Low	143 Å²	143	115.3 Å²	115.3	77%	0.765	63%	0.626	S	S	*	*	S	Bend	trans	-108.5	4.2	-173.9	-157.7	33.3	0	0	0	114.1	L24 Y25 S26	L24-N28 WeakPolarHBondContact O-CB 3.12Å; L24-N28 PolarHBondContact O-N 2.93Å; L24-N28 VanDerWaalsContact O-N 3.16Å; Y25-N28 PolarHBondContact O-N 3.49Å; Y25-N28 VanDerWaalsContact O-N 3.1Å; S26-N28 VanDerWaalsContact C-N 3.34Å
29	S	49.3	Very low	61.6	Low	76 Å²	76	118.5 Å²	118.5	53%	0.531	64%	0.643	S	S	.	*			trans	-99.3	27.2	-179.9	82.7	0	0	0	0	114.3	Y25 N31	Y25-S29 PolarHBondContact O-N 3.17Å; S29-N31 PolarHBondContact O-N 2.95Å
30	A	48.2	Very low	59	Low	82 Å²	82	125.7 Å²	125.7	68%	0.678	67%	0.665	S	S	*	*			trans	-78.7	73.3	161.5	0	0	0	0	0	108.5	E32	A30-E32 PolarHBondContact O-N 3.16Å
31	N	47.1	Very low	56.4	Low	147 Å²	147	126.6 Å²	126.6	79%	0.786	69%	0.685	S	S	*	*			trans	-79.3	68	172.6	-146.9	45.8	0	0	0	108.7	S29 V33	S29-N31 PolarHBondContact O-N 2.95Å; N31-V33 PolarHBondContact O-N 2.87Å
32	E	45.4	Very low	53.6	Low	136 Å²	136	133.2 Å²	133.2	64%	0.636	70%	0.703	S	S	*	*			trans	-85.5	92.5	178.6	-75.1	-64.3	167.9	0	0	109.5	A30 F34	A30-E32 PolarHBondContact O-N 3.16Å; E32-F34 HydrophobicContact CB-CD2 3.89Å; E32-F34 HydrophobicContact CB-CE2 4.27Å; E32-F34 HydrophobicContact CG-CD2 4.38Å; E32-F34 HydrophobicContact CG-CE2 4.27Å; E32-F34 PolarHBondContact O-N 2.96Å; E32-F34 WeakPolarHBondContact OE2-CD2 3.38Å; E32-F34 WeakPolarHBondContact OE2-CE2 3.42Å
33	V	42.4	Very low	51.5	Low	104 Å²	104	133.6 Å²	133.6	63%	0.63	71%	0.71	S	S	*	*			trans	-74.1	73.1	169.2	-177.4	0	0	0	0	108.4	N31 H35	N31-V33 PolarHBondContact O-N 2.87Å; V33-H35 PolarHBondContact O-N 3.02Å
34	F	43.4	Very low	49.6	Very low	154 Å²	154	140.3 Å²	140.3	68%	0.675	73%	0.729	S	S	*	*			trans	-89.8	99.1	173.3	-89.4	-71	0	0	0	111.1	E32 Y36	E32-F34 HydrophobicContact CB-CD2 3.89Å; E32-F34 HydrophobicContact CB-CE2 4.27Å; E32-F34 HydrophobicContact CG-CD2 4.38Å; E32-F34 HydrophobicContact CG-CE2 4.27Å; E32-F34 PolarHBondContact O-N 2.96Å; E32-F34 WeakPolarHBondContact OE2-CD2 3.38Å; E32-F34 WeakPolarHBondContact OE2-CE2 3.42Å; F34-Y36 PolarHBondContact O-N 3.44Å; F34-Y36 VanDerWaalsContact O-N 3.11Å
35	H	37.2	Very low	47.6	Very low	169 Å²	169	145.9 Å²	145.9	78%	0.782	74%	0.742	S	S	*	*			trans	-68.6	100	166.4	-70.2	-74.6	0	0	0	110.1	V33 G37	V33-H35 PolarHBondContact O-N 3.02Å; H35-G37 VanDerWaalsContact C-N 3.25Å; H35-G37 PolarHBondContact O-N 3.46Å
36	Y	39.1	Very low	45.7	Very low	230 Å²	230	143.8 Å²	143.8	90%	0.902	75%	0.75	S	S	*	*			trans	-66.8	87.8	163	-86.2	-87.1	0	0	0	109.4	F34 S38	F34-Y36 PolarHBondContact O-N 3.44Å; F34-Y36 VanDerWaalsContact O-N 3.11Å; Y36-S38 PolarHBondContact O-N 2.85Å
37	G	40.3	Very low	44.6	Very low	62 Å²	62	146 Å²	146	64%	0.639	76%	0.76	S	S	*	*			trans	-66.8	115.5	170.7	0	0	0	0	0	110.9	H35 L39	H35-G37 VanDerWaalsContact C-N 3.25Å; H35-G37 PolarHBondContact O-N 3.46Å; G37-L39 PolarHBondContact O-N 3.35Å; G37-L39 VanDerWaalsContact O-N 3.15Å
38	S	45.9	Very low	43.7	Very low	113 Å²	113	147.2 Å²	147.2	79%	0.79	76%	0.76	S	S	*	*			trans	-48	109.6	171.3	178.5	0	0	0	0	112.5	Y36	Y36-S38 PolarHBondContact O-N 2.85Å
39	L	43.8	Very low	43.5	Very low	173 Å²	173	147.2 Å²	147.2	91%	0.906	76%	0.759	S	S	*	*			trans	-112.3	87.3	168.7	-83.7	162.4	0	0	0	110.8	G37	G37-L39 PolarHBondContact O-N 3.35Å; G37-L39 VanDerWaalsContact O-N 3.15Å
40	R	40.3	Very low	43.3	Very low	236 Å²	236	153.2 Å²	153.2	89%	0.891	78%	0.775	S	S	*	*			trans	-47.5	142.7	161.5	-156.8	171.3	-175.1	174.4	1.1	110.9
41	G	40.2	Very low	43.1	Very low	72 Å²	72	158.1 Å²	158.1	74%	0.742	78%	0.781	S	S	*	*			trans	-63.4	158.2	-158.9	0	0	0	0	0	118.2
42	R	35.3	Very low	43.1	Very low	246 Å²	246	159.1 Å²	159.1	93%	0.928	77%	0.774	S	S	*	*			trans	-163.1	127.6	147.8	-143	169.2	-176.2	151.4	-0.4	111.2
43	T	43.4	Very low	42.7	Very low	124 Å²	124	157.3 Å²	157.3	76%	0.761	78%	0.777	S	S	*	*			trans	-69.3	151.8	167.1	39.8	0	0	0	0	111.2
44	R	45.8	Very low	43	Very low	235 Å²	235	162 Å²	162	89%	0.887	79%	0.789	S	S	*	*			trans	106.6	106.3	160.4	-61.2	179.9	173.9	174.6	-1.3	117.6
45	R	41.2	Very low	43.3	Very low	231 Å²	231	159.9 Å²	159.9	87%	0.872	79%	0.793	S	S	*	*				162.7	149.4	117.9	-88.5	179.1	-178.9	-166	0.8	109.1	V47	R45-V47 PolarHBondContact O-N 2.82Å
46	P	40.3	Very low	44.1	Very low	127 Å²	127	155.2 Å²	155.2	83%	0.825	78%	0.779	S	S	*	*			trans	-59	127.5	173.8	24.6	-31.2	0	0	0	108.9	N48	P46-N48 PolarHBondContact O-N 2.91Å
47	V	47.2	Very low	45	Very low	119 Å²	119	148 Å²	148	72%	0.721	77%	0.767	S	S	*	*			trans	-70.8	117.9	-167.9	-146.9	0	0	0	0	108.6	R45 L49	R45-V47 PolarHBondContact O-N 2.82Å; V47-L49 PolarHBondContact O-N 3.33Å; V47-L49 VanDerWaalsContact O-N 3.09Å
48	N	44.3	Very low	45.9	Very low	113 Å²	113	148.3 Å²	148.3	60%	0.604	75%	0.75	S	S	*	*			trans	-76	98.2	175.2	-172.7	-41	0	0	0	108.8	P46 K50 K51	P46-N48 PolarHBondContact O-N 2.91Å; N48-K50 PolarHBondContact O-N 3.5Å; N48-K50 WeakPolarHBondContact OD1-CB 3.39Å; N48-K50 PolarHBondContact OD1-N 2.71Å; N48-K50 VanDerWaalsContact OD1-N 3.15Å; N48-K51 PolarHBondContact O-N 3.48Å; N48-K51 VanDerWaalsContact O-N 3.13Å
49	L	53.4	Low	46.9	Very low	142 Å²	142	150.7 Å²	150.7	74%	0.743	75%	0.746	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	-16.1	-176.4	-67.1	165.6	0	0	0	113.9	V47	V47-L49 PolarHBondContact O-N 3.33Å; V47-L49 VanDerWaalsContact O-N 3.09Å
50	K	45.4	Very low	47.8	Very low	203 Å²	203	147.9 Å²	147.9	88%	0.883	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	-15.6	178.6	-111.3	-176	179.7	-170.5	0	114.1	N48	N48-K50 PolarHBondContact O-N 3.5Å; N48-K50 WeakPolarHBondContact OD1-CB 3.39Å; N48-K50 PolarHBondContact OD1-N 2.71Å; N48-K50 VanDerWaalsContact OD1-N 3.15Å
51	K	43.9	Very low	49	Very low	184 Å²	184	141 Å²	141	80%	0.8	72%	0.718	S	S	*	*	S	Bend	trans	-99.5	-11.8	-172.8	-158.4	177.3	-179.7	-178.1	0	113.8	N48 S53	N48-K51 PolarHBondContact O-N 3.48Å; N48-K51 VanDerWaalsContact O-N 3.13Å; K51-S53 PolarHBondContact O-N 3.31Å
52	W	45.8	Very low	50.1	Low	169 Å²	169	145 Å²	145	64%	0.64	72%	0.722	S	S	*	*	S	Bend	trans	-82.5	98.3	173.4	-109.3	52.3	0	0	0	108.7	F54	W52-F54 PolarHBondContact O-N 2.99Å
53	S	38.7	Very low	51.6	Low	98 Å²	98	136.8 Å²	136.8	69%	0.685	71%	0.713	S	S	*	*			trans	-43	131.5	167.1	180	0	0	0	0	109.6	K51 S55	K51-S53 PolarHBondContact O-N 3.31Å; S53-S55 PolarHBondContact O-N 3.32Å
54	F	47.5	Very low	52.3	Low	203 Å²	203	138.4 Å²	138.4	89%	0.89	72%	0.717	S	S	*	*	S	Bend	trans	-60.6	38.4	176.1	-82	-99.3	0	0	0	113.4	W52 S56	W52-F54 PolarHBondContact O-N 2.99Å; F54-S56 VanDerWaalsContact C-N 3.27Å; F54-S56 PolarHBondContact O-N 2.76Å
55	S	51.1	Low	53.3	Low	109 Å²	109	134.3 Å²	134.3	76%	0.762	71%	0.706	S	S	*	*	S	Bend	trans	-73.6	-19.7	-173.2	-173.1	0	0	0	0	112.9	S53	S53-S55 PolarHBondContact O-N 3.32Å
56	S	53.4	Low	54.6	Low	70 Å²	70	129.3 Å²	129.3	49%	0.49	70%	0.701	S	S	.	*	S	Bend	trans	-137.3	126.9	168.4	55.2	0	0	0	0	107.3	F54 Y58	F54-S56 VanDerWaalsContact C-N 3.27Å; F54-S56 PolarHBondContact O-N 2.76Å; S56-Y58 PolarHBondContact O-N 3.47Å
57	A	58.6	Low	56.1	Low	79 Å²	79	126.9 Å²	126.9	65%	0.653	68%	0.681	S	S	*	*	S	Bend	trans	-68.3	24.6	-178.9	0	0	0	0	0	113.5
58	Y	58.8	Low	57	Low	68 Å²	68	127.1 Å²	127.1	27%	0.267	69%	0.685	S	S	.	*			trans	-135.9	138.6	-166.7	-72.2	-91.1	0	0	0	111.5	S56 R100 A104	S56-Y58 PolarHBondContact O-N 3.47Å; Y58-R100 HydrophobicContact CE1-CB 3.86Å; Y58-R100 HydrophobicContact CE1-CG 4.49Å; Y58-R100 PolarHBondContact OH-NH1 3.28Å; Y58-A104 PolarHBondContact OH-O 3.26Å
59	F	65.5	Low	58.3	Low	164 Å²	164	124.5 Å²	124.5	72%	0.719	68%	0.675	S	S	*	*			trans	-105.2	108.1	167.4	-72	-83.6	0	0	0	109.1	I61	F59-I61 PolarHBondContact O-N 3.06Å
60	P	63.5	Low	59.6	Low	113 Å²	113	129.7 Å²	129.7	73%	0.734	69%	0.685	S	S	*	*			trans	-70.2	124.1	178.8	27.6	-32.9	0	0	0	110.3
61	I	64.8	Low	61.5	Low	93 Å²	93	121.7 Å²	121.7	48%	0.477	65%	0.654	S	S	.	*			trans	-99.2	111.4	174.2	-51.1	173.1	0	0	0	107.5	F59 K65 L67	F59-I61 PolarHBondContact O-N 3.06Å; I61-K65 HydrophobicContact CG2-CB 4.07Å; I61-K65 WeakPolarHBondContact CG2-O 3.49Å; I61-L67 HydrophobicContact CD1-CB 4.47Å; I61-L67 HydrophobicContact CD1-CD1 3.19Å; I61-L67 HydrophobicContact CD1-CG 4.42Å; I61-L67 HydrophobicContact CG1-CD1 4.2Å
62	L	64.6	Low	63.3	Low	156 Å²	156	120.4 Å²	120.4	82%	0.817	66%	0.656	S	S	*	*			trans	-101.4	126.3	-178	-166.7	72.6	0	0	0	111	K65	L62-K65 WeakPolarHBondContact O-CG 3.37Å
63	G	66.5	Low	65.2	Low	72 Å²	72	117.5 Å²	117.5	74%	0.742	65%	0.649	S	S	*	*	S	Bend	trans	73.1	-140.8	171.5	0	0	0	0	0	114.4	K65	G63-K65 PolarHBondContact O-N 2.96Å
64	N	57.7	Low	67.4	Low	159 Å²	159	116.2 Å²	116.2	85%	0.85	64%	0.64	S	S	*	*	S	Bend	trans	-86.9	27.1	-176.3	62.7	-6.3	0	0	0	114
65	K	66.8	Low	69.4	Low	148 Å²	148	108.3 Å²	108.3	64%	0.643	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-80.5	134.5	-179.8	-64	-79.4	-177.5	175.2	0	109.5	I61 L62 G63	I61-K65 HydrophobicContact CG2-CB 4.07Å; I61-K65 WeakPolarHBondContact CG2-O 3.49Å; L62-K65 WeakPolarHBondContact O-CG 3.37Å; G63-K65 PolarHBondContact O-N 2.96Å
66	T	68.6	Low	71.2	Confident	126 Å²	126	109.2 Å²	109.2	77%	0.773	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-73.9	147.1	168.4	38.5	0	0	0	0	110.6
67	L	71.1	Confident	72.7	Confident	77 Å²	77	107 Å²	107	40%	0.403	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-58.3	126.9	172.8	-167.9	73.5	0	0	0	108.6	I61 S69	I61-L67 HydrophobicContact CD1-CB 4.47Å; I61-L67 HydrophobicContact CD1-CD1 3.19Å; I61-L67 HydrophobicContact CD1-CG 4.42Å; I61-L67 HydrophobicContact CG1-CD1 4.2Å; L67-S69 PolarHBondContact O-N 3.34Å
68	P	67.8	Low	73.8	Confident	124 Å²	124	107 Å²	107	81%	0.805	58%	0.577	S	S	*	*	S	Bend	trans	-72.5	-17	-173	27.4	-33.9	0	0	0	113.2
69	S	71.7	Confident	74.8	Confident	57 Å²	57	107.9 Å²	107.9	40%	0.399	59%	0.593	S	S	.	*			trans	-94.8	142.4	179.8	43.2	0	0	0	0	112.1	L67	L67-S69 PolarHBondContact O-N 3.34Å
70	R	80.6	Confident	75.6	Confident	251 Å²	251	102 Å²	102	95%	0.947	57%	0.572	S	S	*	*			trans	-109.5	120.8	164.9	-64.9	-175.9	-179.1	-119.8	1.4	107.2
71	C	83.8	Confident	76.4	Confident	35 Å²	35	100.6 Å²	100.6	24%	0.236	57%	0.566	C	S	.	*			trans	-122.7	142.6	179.7	-71.5	0	0	0	0	108.9	E96 C97	C71-E96 WeakPolarHBondContact CA-OE2 2.95Å; C71-E96 HydrophobicContact CB-CB 3.94Å; C71-E96 VanDerWaalsContact SG-C 3.59Å; C71-C97 HydrophobicContact CB-CB 3.56Å; C71-C97 WeakPolarHBondContact CB-SG 3.49Å; C71-C97 WeakPolarHBondContact SG-CB 3.42Å; C71-C97 CovalentContact SG-SG 2.03Å; C71-C97 PolarHBondContact SG-SG 3.09Å
72	N	83.6	Confident	77.3	Confident	158 Å²	158	103.9 Å²	103.9	85%	0.845	58%	0.579	S	S	*	*	S	Bend	trans	-81.7	-32.5	174.1	-64.2	-44.8	0	0	0	111.2	E96	N72-E96 PolarHBondContact N-OE2 3.31Å
73	Q	84.3	Confident	78.2	Confident	107 Å²	107	99.4 Å²	99.4	50%	0.5	56%	0.555	S	S	.	*	S	Bend	trans	-123.2	120.7	178.3	-174.4	176.2	-11.7	0	0	110.7	E96 C97	Q73-E96 PolarHBondContact O-N 3.11Å; Q73-C97 PolarHBondContact O-N 3.33Å
74	C	85.9	Confident	78.9	Confident	71 Å²	71	102.8 Å²	102.8	48%	0.48	56%	0.556	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.5	143	-179.6	-62.7	0	0	0	0	110.5	C97	C74-C97 CarbonylContact C-O 3.59Å; C74-C97 WeakPolarHBondContact CA-O 3.41Å; C74-C97 HydrophobicContact CB-CB 4.46Å
75	V	88.8	Confident	80.1	Confident	37 Å²	37	98.8 Å²	98.8	22%	0.224	55%	0.552	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.2	129.9	169.6	170.1	0	0	0	0	109.3	I77 I92 A95 C97 T98 I99	V75-I77 HydrophobicContact CG1-CG1 4.08Å; V75-I92 HydrophobicContact CG1-CG1 4.22Å; V75-I92 HydrophobicContact CG1-CG2 4.44Å; V75-A95 HydrophobicContact CB-CB 3.97Å; V75-A95 HydrophobicContact CG2-CB 3.5Å; V75-C97 PolarHBondContact N-O 3.15Å; V75-T98 WeakPolarHBondContact O-CA 3.17Å; V75-I99 PolarHBondContact O-N 3.1Å
76	I	88.8	Confident	80.9	Confident	129 Å²	129	94.7 Å²	94.7	66%	0.662	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.7	121.6	175	-58.7	176.1	0	0	0	108	I99	I76-I99 HydrophobicContact CG1-CB 4.5Å
77	I	85.3	Confident	81.6	Confident	23 Å²	23	97.7 Å²	97.7	12%	0.118	54%	0.542	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	117.4	-178.5	-53.8	-176.8	0	0	0	109.5	V75 L83 I92 T98 I99 R100	V75-I77 HydrophobicContact CG1-CG1 4.08Å; I77-L83 HydrophobicContact CG2-CD1 3.66Å; I77-I92 HydrophobicContact CD1-CD1 4.08Å; I77-I92 HydrophobicContact CD1-CG2 3.68Å; I77-T98 HydrophobicContact CD1-CG2 3.42Å; I77-T98 VanDerWaalsContact CD1-CG2 3.42Å; I77-T98 HydrophobicContact CG1-CG2 3.97Å; I77-I99 PolarHBondContact N-O 3.16Å; I77-R100 HydrophobicContact CB-CG 4.31Å; I77-R100 HydrophobicContact CD1-CG 4.04Å; I77-R100 HydrophobicContact CG1-CG 4.45Å
78	T	81.9	Confident	82.3	Confident	79 Å²	79	97 Å²	97	49%	0.485	54%	0.538	S	S	.	.			trans	-75.1	150.7	169.3	178.3	0	0	0	0	111.2	S80 L83	T78-S80 PolarHBondContact O-N 3.32Å; T78-S80 PolarHBondContact OG1-N 3.4Å; T78-L83 HydrophobicContact CG2-CD1 4.06Å; T78-L83 HydrophobicContact CG2-CG 4.27Å; T78-L83 WeakPolarHBondContact O-CD1 3.25Å
79	S	79.5	Confident	83.1	Confident	86 Å²	86	92.8 Å²	92.8	60%	0.601	52%	0.517	S	S	*	.			trans	-83	22.2	172.9	61.7	0	0	0	0	113.3
80	S	81.9	Confident	83.7	Confident	40 Å²	40	93.9 Å²	93.9	28%	0.28	52%	0.522	S	S	.	.			trans	-75.6	140.1	-178.5	-175.8	0	0	0	0	112.2	T78 H82 L83	T78-S80 PolarHBondContact O-N 3.32Å; T78-S80 PolarHBondContact OG1-N 3.4Å; S80-H82 PolarHBondContact O-N 2.86Å; S80-H82 VanDerWaalsContact O-N 3.14Å; S80-H82 PolarHBondContact OG-N 2.9Å; S80-H82 PolarHBondContact OG-ND1 3.24Å; S80-L83 PolarHBondContact O-N 3.4Å
81	S	81.2	Confident	83.9	Confident	85 Å²	85	87.3 Å²	87.3	59%	0.594	50%	0.502	S	S	*	.	G	3₁₀ helix	trans	-61.8	-16.1	171.6	54.9	0	0	0	0	113.7	L83 L84	S81-L83 PolarHBondContact O-N 3.04Å; S81-L83 VanDerWaalsContact O-N 3.11Å; S81-L84 VanDerWaalsContact O-CB 3.28Å; S81-L84 WeakPolarHBondContact O-CB 3.31Å; S81-L84 VanDerWaalsContact O-CG 3.29Å; S81-L84 WeakPolarHBondContact O-CG 3.25Å; S81-L84 PolarHBondContact O-N 2.94Å
82	H	82.3	Confident	83.9	Confident	161 Å²	161	87.5 Å²	87.5	75%	0.745	50%	0.501	S	S	*	.	G	3₁₀ helix	trans	-61.3	-16.3	172.9	-69.6	126.2	0	0	0	113.8	S80 L84 T86	S80-H82 PolarHBondContact O-N 2.86Å; S80-H82 VanDerWaalsContact O-N 3.14Å; S80-H82 PolarHBondContact OG-N 2.9Å; S80-H82 PolarHBondContact OG-ND1 3.24Å; H82-L84 VanDerWaalsContact C-N 3.31Å; H82-T86 WeakPolarHBondContact O-CG2 3.48Å
83	L	83.4	Confident	83.8	Confident	62 Å²	62	87.7 Å²	87.7	33%	0.325	50%	0.497	S	S	.	.	G	3₁₀ helix	trans	-77.7	-16.2	173.9	-63.5	-176.8	0	0	0	113.2	I77 T78 S80 S81 G85 T86 L88	I77-L83 HydrophobicContact CG2-CD1 3.66Å; T78-L83 HydrophobicContact CG2-CD1 4.06Å; T78-L83 HydrophobicContact CG2-CG 4.27Å; T78-L83 WeakPolarHBondContact O-CD1 3.25Å; S80-L83 PolarHBondContact O-N 3.4Å; S81-L83 PolarHBondContact O-N 3.04Å; S81-L83 VanDerWaalsContact O-N 3.11Å; L83-G85 PolarHBondContact O-N 2.77Å; L83-T86 WeakPolarHBondContact O-CB 3.49Å; L83-T86 WeakPolarHBondContact O-CG2 3.33Å; L83-T86 PolarHBondContact O-N 3.26Å; L83-T86 PolarHBondContact O-OG1 2.66Å; L83-L88 HydrophobicContact CD2-CD1 4.23Å
84	L	82.4	Confident	83.8	Confident	144 Å²	144	91.1 Å²	91.1	75%	0.754	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	132.1	-179.9	-63.7	174.6	0	0	0	110.7	S81 H82 T86	S81-L84 VanDerWaalsContact O-CB 3.28Å; S81-L84 WeakPolarHBondContact O-CB 3.31Å; S81-L84 VanDerWaalsContact O-CG 3.29Å; S81-L84 WeakPolarHBondContact O-CG 3.25Å; S81-L84 PolarHBondContact O-N 2.94Å; H82-L84 VanDerWaalsContact C-N 3.31Å; L84-T86 PolarHBondContact O-N 2.9Å; L84-T86 VanDerWaalsContact O-N 3.15Å
85	G	82.1	Confident	83.9	Confident	75 Å²	75	88.3 Å²	88.3	77%	0.773	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.6	-2.1	178.5	0	0	0	0	0	115.7	L83 K87	L83-G85 PolarHBondContact O-N 2.77Å; G85-K87 PolarHBondContact O-N 2.03Å
86	T	83.8	Confident	83.6	Confident	61 Å²	61	92 Å²	92	37%	0.374	50%	0.502	S	S	.	.			trans	-69.5	-21.1	-179.3	61.3	0	0	0	0	113.8	H82 L83 L84 L88	H82-T86 WeakPolarHBondContact O-CG2 3.48Å; L83-T86 WeakPolarHBondContact O-CB 3.49Å; L83-T86 WeakPolarHBondContact O-CG2 3.33Å; L83-T86 PolarHBondContact O-N 3.26Å; L83-T86 PolarHBondContact O-OG1 2.66Å; L84-T86 PolarHBondContact O-N 2.9Å; L84-T86 VanDerWaalsContact O-N 3.15Å; T86-L88 HydrophobicContact CG2-CD1 4.4Å; T86-L88 PolarHBondContact O-N 3.16Å; T86-L88 WeakPolarHBondContact OG1-CG 3.35Å
87	K	84	Confident	83.4	Confident	189 Å²	189	86.5 Å²	86.5	82%	0.822	48%	0.475	S	S	*	.			trans	56.4	28.4	-177.4	-55.5	178	-177.6	178.4	0	113.7	G85 G89 P90	G85-K87 PolarHBondContact O-N 2.03Å; K87-G89 PolarHBondContact O-N 2.76Å; K87-P90 WeakPolarHBondContact O-CD 3.34Å
88	L	84.7	Confident	83.3	Confident	64 Å²	64	88.4 Å²	88.4	34%	0.335	49%	0.487	S	S	.	.			trans	-72.1	-4.5	179.4	-68.4	169.9	0	0	0	114.4	L83 T86 E91 I92	L83-L88 HydrophobicContact CD2-CD1 4.23Å; T86-L88 HydrophobicContact CG2-CD1 4.4Å; T86-L88 PolarHBondContact O-N 3.16Å; T86-L88 WeakPolarHBondContact OG1-CG 3.35Å; L88-E91 WeakPolarHBondContact CD2-OE2 3.05Å; L88-E91 WeakPolarHBondContact O-CB 3.35Å; L88-E91 PolarHBondContact O-N 3.37Å; L88-I92 HydrophobicContact CB-CD1 3.99Å; L88-I92 HydrophobicContact CB-CG1 4.36Å; L88-I92 WeakPolarHBondContact O-CG1 3.1Å; L88-I92 PolarHBondContact O-N 2.71Å
89	G	84.6	Confident	83.4	Confident	34 Å²	34	87.9 Å²	87.9	35%	0.351	48%	0.481	S	S	.	.	H	α-helix	trans	-46.7	-55.6	-177.9	0	0	0	0	0	113.9	K87 E91 I92 E93	K87-G89 PolarHBondContact O-N 2.76Å; G89-E91 PolarHBondContact O-N 2.73Å; G89-E91 VanDerWaalsContact O-N 3.16Å; G89-I92 WeakPolarHBondContact O-CB 3.35Å; G89-I92 PolarHBondContact O-N 3.38Å; G89-I92 VanDerWaalsContact O-N 3.17Å; G89-E93 WeakPolarHBondContact O-CG 3.09Å; G89-E93 PolarHBondContact O-N 2.77Å
90	P	85.3	Confident	83.4	Confident	80 Å²	80	86.3 Å²	86.3	52%	0.519	46%	0.462	S	S	.	.	H	α-helix	trans	-63.8	-20.8	179.1	-24.6	35.3	0	0	0	115.1	K87 R94	K87-P90 WeakPolarHBondContact O-CD 3.34Å; P90-R94 WeakPolarHBondContact O-CG 3.48Å; P90-R94 PolarHBondContact O-NE 3.21Å
91	E	83.8	Confident	83.1	Confident	113 Å²	113	90 Å²	90	53%	0.528	48%	0.476	S	S	.	.	H	α-helix	trans	-82.7	-41.2	175	-175.5	175.3	175.4	0	0	111.1	L88 G89 E93 R94	L88-E91 WeakPolarHBondContact CD2-OE2 3.05Å; L88-E91 WeakPolarHBondContact O-CB 3.35Å; L88-E91 PolarHBondContact O-N 3.37Å; G89-E91 PolarHBondContact O-N 2.73Å; G89-E91 VanDerWaalsContact O-N 3.16Å; E91-E93 VanDerWaalsContact C-N 3.33Å; E91-E93 PolarHBondContact O-N 3.25Å; E91-R94 PolarHBondContact O-N 2.95Å
92	I	85.1	Confident	82.7	Confident	39 Å²	39	91.8 Å²	91.8	20%	0.2	48%	0.479	C	S	.	.	H	α-helix	trans	-60.1	-44.1	173.9	-66.6	165	0	0	0	110.4	V75 I77 L88 G89 R94 A95 T98	V75-I92 HydrophobicContact CG1-CG1 4.22Å; V75-I92 HydrophobicContact CG1-CG2 4.44Å; I77-I92 HydrophobicContact CD1-CD1 4.08Å; I77-I92 HydrophobicContact CD1-CG2 3.68Å; L88-I92 HydrophobicContact CB-CD1 3.99Å; L88-I92 HydrophobicContact CB-CG1 4.36Å; L88-I92 WeakPolarHBondContact O-CG1 3.1Å; L88-I92 PolarHBondContact O-N 2.71Å; G89-I92 WeakPolarHBondContact O-CB 3.35Å; G89-I92 PolarHBondContact O-N 3.38Å; G89-I92 VanDerWaalsContact O-N 3.17Å; I92-R94 PolarHBondContact O-N 3.13Å; I92-A95 WeakPolarHBondContact O-CB 3.35Å; I92-A95 PolarHBondContact O-N 3.06Å; I92-T98 HydrophobicContact CG2-CG2 4.06Å
93	E	81.6	Confident	82.1	Confident	163 Å²	163	91.2 Å²	91.2	76%	0.762	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.3	-17.6	-179.3	-75.4	176	178.9	0	0	114.1	G89 E91 A95	G89-E93 WeakPolarHBondContact O-CG 3.09Å; G89-E93 PolarHBondContact O-N 2.77Å; E91-E93 VanDerWaalsContact C-N 3.33Å; E91-E93 PolarHBondContact O-N 3.25Å; E93-A95 VanDerWaalsContact C-N 3.32Å
94	R	84.1	Confident	81.3	Confident	178 Å²	178	89.1 Å²	89.1	67%	0.672	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.4	-17	174.5	-67.4	178.2	-145.3	137.8	2.9	113.2	P90 E91 I92	P90-R94 WeakPolarHBondContact O-CG 3.48Å; P90-R94 PolarHBondContact O-NE 3.21Å; E91-R94 PolarHBondContact O-N 2.95Å; I92-R94 PolarHBondContact O-N 3.13Å
95	A	86.4	Confident	80.5	Confident	13 Å²	13	87.4 Å²	87.4	11%	0.107	47%	0.471	C	S	.	.	S	Bend	trans	-72.7	139.6	-178.7	0	0	0	0	0	111	V75 I92 E93 C97	V75-A95 HydrophobicContact CB-CB 3.97Å; V75-A95 HydrophobicContact CG2-CB 3.5Å; I92-A95 WeakPolarHBondContact O-CB 3.35Å; I92-A95 PolarHBondContact O-N 3.06Å; E93-A95 VanDerWaalsContact C-N 3.32Å; A95-C97 VanDerWaalsContact C-N 3.3Å; A95-C97 PolarHBondContact O-N 3.43Å
96	E	83.9	Confident	80	Confident	114 Å²	114	89 Å²	89	53%	0.533	47%	0.465	S	S	.	.	S	Bend	trans	-65.3	-37.6	175.9	-62.3	176.1	177.7	0	0	111.4	C71 N72 Q73	C71-E96 WeakPolarHBondContact CA-OE2 2.95Å; C71-E96 HydrophobicContact CB-CB 3.94Å; C71-E96 VanDerWaalsContact SG-C 3.59Å; N72-E96 PolarHBondContact N-OE2 3.31Å; Q73-E96 PolarHBondContact O-N 3.11Å
97	C	83.4	Confident	79.1	Confident	13 Å²	13	91 Å²	91	9%	0.088	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	128.1	176.3	-83.3	0	0	0	0	110.9	C71 Q73 C74 V75 A95	C71-C97 HydrophobicContact CB-CB 3.56Å; C71-C97 WeakPolarHBondContact CB-SG 3.49Å; C71-C97 WeakPolarHBondContact SG-CB 3.42Å; C71-C97 CovalentContact SG-SG 2.03Å; C71-C97 PolarHBondContact SG-SG 3.09Å; Q73-C97 PolarHBondContact O-N 3.33Å; C74-C97 CarbonylContact C-O 3.59Å; C74-C97 WeakPolarHBondContact CA-O 3.41Å; C74-C97 HydrophobicContact CB-CB 4.46Å; V75-C97 PolarHBondContact N-O 3.15Å; A95-C97 VanDerWaalsContact C-N 3.3Å; A95-C97 PolarHBondContact O-N 3.43Å
98	T	84.4	Confident	77.9	Confident	63 Å²	63	89.2 Å²	89.2	39%	0.387	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	122.3	169.3	-67	0	0	0	0	109.8	V75 I77 I92 R100	V75-T98 WeakPolarHBondContact O-CA 3.17Å; I77-T98 HydrophobicContact CD1-CG2 3.42Å; I77-T98 VanDerWaalsContact CD1-CG2 3.42Å; I77-T98 HydrophobicContact CG1-CG2 3.97Å; I92-T98 HydrophobicContact CG2-CG2 4.06Å; T98-R100 HydrophobicContact CG2-CG 3.99Å
99	I	83.1	Confident	77.5	Confident	69 Å²	69	90.5 Å²	90.5	35%	0.354	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	121.5	178.9	-56.3	172.1	0	0	0	107.9	V75 I76 I77	V75-I99 PolarHBondContact O-N 3.1Å; I76-I99 HydrophobicContact CG1-CB 4.5Å; I77-I99 PolarHBondContact N-O 3.16Å
100	R	80	Confident	77.2	Confident	52 Å²	52	93.4 Å²	93.4	20%	0.196	54%	0.536	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	141.5	178.2	-53.7	-175.2	76.1	-160.2	8.4	108.9	Y58 I77 T98 A104 P105	Y58-R100 HydrophobicContact CE1-CB 3.86Å; Y58-R100 HydrophobicContact CE1-CG 4.49Å; Y58-R100 PolarHBondContact OH-NH1 3.28Å; I77-R100 HydrophobicContact CB-CG 4.31Å; I77-R100 HydrophobicContact CD1-CG 4.04Å; I77-R100 HydrophobicContact CG1-CG 4.45Å; T98-R100 HydrophobicContact CG2-CG 3.99Å; R100-A104 PolarHBondContact NH1-O 3.26Å; R100-A104 VanDerWaalsContact NH2-CB 3.26Å; R100-A104 PolarHBondContact NH2-O 2.86Å; R100-P105 VanDerWaalsContact NH2-C 3.31Å; R100-P105 PolarHBondContact NH2-O 3.15Å
101	M	75.3	Confident	76.7	Confident	118 Å²	118	94.2 Å²	94.2	58%	0.581	54%	0.536	S	S	*	.			trans	-96.6	140.3	172.9	-60	-177	75.4	0	0	109.2
102	N	73.3	Confident	76.3	Confident	122 Å²	122	93.1 Å²	93.1	65%	0.652	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.2	-164	-179.4	-44.4	-41	0	0	0	113	A104	N102-A104 PolarHBondContact O-N 3.3Å; N102-A104 VanDerWaalsContact O-N 3.16Å
103	D	69	Low	75.7	Confident	150 Å²	150	96.4 Å²	96.4	80%	0.802	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.4	48	180	-59	-37.6	0	0	0	112.1
104	A	67	Low	75.4	Confident	18 Å²	18	92 Å²	92	15%	0.149	54%	0.544	C	S	.	.			trans	-56.9	130.1	176.9	0	0	0	0	0	110.2	Y58 R100 N102	Y58-A104 PolarHBondContact OH-O 3.26Å; R100-A104 PolarHBondContact NH1-O 3.26Å; R100-A104 VanDerWaalsContact NH2-CB 3.26Å; R100-A104 PolarHBondContact NH2-O 2.86Å; N102-A104 PolarHBondContact O-N 3.3Å; N102-A104 VanDerWaalsContact O-N 3.16Å
105	P	66.3	Low	74.7	Confident	108 Å²	108	85.9 Å²	85.9	70%	0.701	54%	0.535	S	S	*	.			trans	-70.7	136.7	-177.6	26.2	-33.5	0	0	0	111.2	R100	R100-P105 VanDerWaalsContact NH2-C 3.31Å; R100-P105 PolarHBondContact NH2-O 3.15Å
106	T	71.8	Confident	73.8	Confident	107 Å²	107	91.5 Å²	91.5	66%	0.656	57%	0.568	S	S	*	*	S	Bend	trans	-97.4	-20.4	170.9	30.4	0	0	0	0	112.8
107	S	64.5	Low	73	Confident	103 Å²	103	89.6 Å²	89.6	72%	0.72	57%	0.571	S	S	*	*			trans	-101.8	135.4	174	52.3	0	0	0	0	109.2
108	G	57.9	Low	72	Confident	152 Å²	152	96.5 Å²	96.5	100%	1.567	62%	0.615	S	S	*	*			trans	-139.7	0	173.2	0	0	0	0	0	110.2

Retrieved 108 of 108 residues in 42.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).