Z4YMU7_MOUSE Loading...

Proline-rich nuclear receptor coactivator 2

AlphaFold DB , UniProt , Accession Z4YMU7, Species MOUSE (Mus musculus, Mouse), Gene Pnrc2, Length 37 aa.

						>Z4YMU7_MOUSE|Z4YMU7|Pnrc2
MGGGERYNIPDPQSRNASKNQEQQNRQKSKDQNSSQT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	72.1	Confident	76.7	Confident	253 Å²	253	144.7 Å²	144.7	100%	1.246	80%	0.804	S	S	*	*				0	127.1	0	-71.9	171.7	172	0	0	107.7
2	G	70.4	Confident	77	Confident	83 Å²	83	141.8 Å²	141.8	86%	0.856	80%	0.796	S	S	*	*			trans	153.6	55.7	172.5	0	0	0	0	0	115.2	G4	G2-G4 PolarHBondContact O-N 3.3Å
3	G	77.9	Confident	77	Confident	73 Å²	73	145.2 Å²	145.2	75%	0.753	80%	0.802	S	S	*	*			trans	-81	105.8	168.5	0	0	0	0	0	109.6	E5	G3-E5 PolarHBondContact O-N 3.25Å
4	G	77.1	Confident	77	Confident	61 Å²	61	141.6 Å²	141.6	63%	0.629	79%	0.792	S	S	*	*			trans	-87.7	70.6	177.6	0	0	0	0	0	111.2	G2 R6	G2-G4 PolarHBondContact O-N 3.3Å; G4-R6 PolarHBondContact O-N 3.16Å; G4-R6 VanDerWaalsContact O-N 3.15Å
5	E	77.7	Confident	76.4	Confident	157 Å²	157	147.1 Å²	147.1	73%	0.734	80%	0.796	S	S	*	*			trans	-66.1	112.3	173.5	-63.9	178.7	98.5	0	0	108.8	G3 Y7	G3-E5 PolarHBondContact O-N 3.25Å; E5-Y7 PolarHBondContact O-N 3.49Å
6	R	76.5	Confident	75.5	Confident	226 Å²	226	144.4 Å²	144.4	85%	0.853	78%	0.78	S	S	*	*			trans	-87.2	104	175.3	-55.4	-61.4	-173.5	174.4	1.3	106.9	G4 N8	G4-R6 PolarHBondContact O-N 3.16Å; G4-R6 VanDerWaalsContact O-N 3.15Å; R6-N8 PolarHBondContact O-N 3.41Å
7	Y	77.1	Confident	74.8	Confident	189 Å²	189	140.7 Å²	140.7	74%	0.741	77%	0.774	S	S	*	*			trans	-57.8	128.8	171.9	-58.5	-79.1	0	0	0	109.1	E5 I9	E5-Y7 PolarHBondContact O-N 3.49Å; Y7-I9 PolarHBondContact O-N 3.34Å
8	N	79.2	Confident	74.5	Confident	167 Å²	167	137.3 Å²	137.3	89%	0.893	76%	0.762	S	S	*	*			trans	-70.4	83	166.9	-83.3	-73.2	0	0	0	107.5	R6 P10	R6-N8 PolarHBondContact O-N 3.41Å; N8-P10 VanDerWaalsContact O-CD 3.31Å; N8-P10 WeakPolarHBondContact O-CD 3.43Å
9	I	79	Confident	74.3	Confident	141 Å²	141	135.9 Å²	135.9	72%	0.723	75%	0.747	S	S	*	*			trans	-76.4	115.8	174.8	-54.7	174.3	0	0	0	106.3	Y7	Y7-I9 PolarHBondContact O-N 3.34Å
10	P	78.1	Confident	74	Confident	108 Å²	108	134.4 Å²	134.4	70%	0.701	74%	0.738	S	S	*	*			trans	-62.1	143.2	173.6	26.7	-32.8	0	0	0	109.3	N8	N8-P10 VanDerWaalsContact O-CD 3.31Å; N8-P10 WeakPolarHBondContact O-CD 3.43Å
11	D	79.1	Confident	74.1	Confident	134 Å²	134	134.3 Å²	134.3	72%	0.717	73%	0.733	S	S	*	*			trans	-55.3	136.4	177.7	-173.6	-101.8	0	0	0	110.4	Q13	D11-Q13 PolarHBondContact O-N 3.49Å
12	P	79.9	Confident	74.5	Confident	109 Å²	109	127.3 Å²	127.3	71%	0.708	70%	0.697	S	S	*	*			trans	-57.1	105.9	177.8	21	-32.1	0	0	0	110.8	S14	P12-S14 PolarHBondContact O-N 3Å
13	Q	77.4	Confident	74.8	Confident	187 Å²	187	127.6 Å²	127.6	87%	0.874	68%	0.676	S	S	*	*			trans	-58.9	122.1	179.7	-70.4	-179.8	-95.2	0	0	110.7	D11 R15	D11-Q13 PolarHBondContact O-N 3.49Å; Q13-R15 PolarHBondContact O-N 3.41Å
14	S	76	Confident	74.6	Confident	94 Å²	94	129.7 Å²	129.7	66%	0.657	67%	0.666	S	S	*	*			trans	-56.3	112.6	174.2	179.5	0	0	0	0	110.4	P12 N16	P12-S14 PolarHBondContact O-N 3Å; S14-N16 PolarHBondContact O-N 3.01Å
15	R	68.9	Low	74.4	Confident	225 Å²	225	131.8 Å²	131.8	85%	0.849	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.2	-2.9	-170.2	-160.2	171.1	-174.3	168.2	2.3	115	Q13	Q13-R15 PolarHBondContact O-N 3.41Å
16	N	62.6	Low	74.3	Confident	103 Å²	103	131.2 Å²	131.2	55%	0.551	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.1	-7.6	-167.6	-67.1	-34.3	0	0	0	115.3	S14	S14-N16 PolarHBondContact O-N 3.01Å
17	A	63.4	Low	74.1	Confident	82 Å²	82	125 Å²	125	68%	0.678	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-39.8	-175.8	0	0	0	0	0	113
18	S	68.8	Low	73.9	Confident	79 Å²	79	122.2 Å²	122.2	55%	0.552	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.4	-19.9	-175.1	-175.3	0	0	0	0	114.1	N20 Q21 E22	S18-N20 VanDerWaalsContact C-N 3.29Å; S18-N20 PolarHBondContact O-N 3.16Å; S18-Q21 PolarHBondContact O-N 3.27Å; S18-Q21 VanDerWaalsContact O-N 3.13Å; S18-E22 VanDerWaalsContact O-N 3.13Å; S18-E22 PolarHBondContact O-N 3.37Å
19	K	71.1	Confident	73.4	Confident	111 Å²	111	118.3 Å²	118.3	48%	0.483	61%	0.612	S	S	.	*	H	α-helix	trans	-61.6	-35.4	-172.3	-162.7	175.7	-176.1	-175.9	0	113.1	Q23	K19-Q23 VanDerWaalsContact O-CG 3.28Å; K19-Q23 WeakPolarHBondContact O-CG 3.45Å; K19-Q23 PolarHBondContact O-N 3.39Å
20	N	68.1	Low	73	Confident	105 Å²	105	119 Å²	119	56%	0.561	61%	0.61	S	S	*	*	H	α-helix	trans	-70.5	-41.7	177.6	-71.1	-60.5	0	0	0	111.9	S18 E22 Q23 Q24	S18-N20 VanDerWaalsContact C-N 3.29Å; S18-N20 PolarHBondContact O-N 3.16Å; N20-E22 PolarHBondContact O-N 3.01Å; N20-Q23 PolarHBondContact O-N 2.62Å; N20-Q24 WeakPolarHBondContact O-CB 3.47Å; N20-Q24 WeakPolarHBondContact O-CG 3.42Å; N20-Q24 PolarHBondContact O-N 3.13Å
21	Q	76.6	Confident	72.3	Confident	134 Å²	134	117.5 Å²	117.5	63%	0.626	60%	0.596	S	S	*	*	H	α-helix	trans	-65.2	-41.5	179.6	-66	-175.8	-8.1	0	0	111.7	S18 Q24 N25	S18-Q21 PolarHBondContact O-N 3.27Å; S18-Q21 VanDerWaalsContact O-N 3.13Å; Q21-Q24 PolarHBondContact O-N 3.48Å; Q21-N25 WeakPolarHBondContact O-CB 3.49Å; Q21-N25 PolarHBondContact O-N 3.35Å; Q21-N25 PolarHBondContact O-ND2 3.02Å
22	E	79.1	Confident	71.6	Confident	105 Å²	105	118.1 Å²	118.1	49%	0.491	59%	0.594	S	S	.	*	H	α-helix	trans	-65.9	-40.6	178.2	-167.7	-171.6	73.7	0	0	112.3	S18 N20 N25 R26	S18-E22 VanDerWaalsContact O-N 3.13Å; S18-E22 PolarHBondContact O-N 3.37Å; N20-E22 PolarHBondContact O-N 3.01Å; E22-N25 PolarHBondContact O-N 3.02Å; E22-R26 PolarHBondContact OE1-NH2 2.94Å; E22-R26 IonicContact OE1-NH2 2.62Å; E22-R26 IonicContact OE1-NE 3.74Å; E22-R26 IonicContact OE1-CZ 3.48Å; E22-R26 PolarHBondContact O-N 2.96Å; E22-R26 PolarHBondContact O-NE 2.98Å; E22-R26 WeakPolarHBondContact O-CB 3.46Å; E22-R26 WeakPolarHBondContact O-CG 3.4Å
23	Q	77.6	Confident	70.6	Confident	89 Å²	89	119 Å²	119	42%	0.416	59%	0.593	S	S	.	*	H	α-helix	trans	-66.6	-41.1	175.9	-73.1	179.1	10.8	0	0	112.2	K19 N20 R26 Q27	K19-Q23 VanDerWaalsContact O-CG 3.28Å; K19-Q23 WeakPolarHBondContact O-CG 3.45Å; K19-Q23 PolarHBondContact O-N 3.39Å; N20-Q23 PolarHBondContact O-N 2.62Å; Q23-R26 PolarHBondContact O-N 3.41Å; Q23-Q27 PolarHBondContact O-N 3.42Å
24	Q	74.5	Confident	69.9	Low	117 Å²	117	114.4 Å²	114.4	55%	0.547	58%	0.582	S	S	.	*	H	α-helix	trans	-64	-41.6	176.4	-69.3	-68.1	-49.7	0	0	111.8	N20 Q21 Q27 K28	N20-Q24 WeakPolarHBondContact O-CB 3.47Å; N20-Q24 WeakPolarHBondContact O-CG 3.42Å; N20-Q24 PolarHBondContact O-N 3.13Å; Q21-Q24 PolarHBondContact O-N 3.48Å; Q24-Q27 PolarHBondContact O-N 2.97Å; Q24-K28 WeakPolarHBondContact O-CG 3.21Å; Q24-K28 PolarHBondContact O-N 3.19Å
25	N	72.3	Confident	69.2	Low	106 Å²	106	114.6 Å²	114.6	57%	0.567	58%	0.583	S	S	*	*	H	α-helix	trans	-66.4	-38.3	176.2	-76.8	-28.6	0	0	0	112.3	Q21 E22 S29	Q21-N25 WeakPolarHBondContact O-CB 3.49Å; Q21-N25 PolarHBondContact O-N 3.35Å; Q21-N25 PolarHBondContact O-ND2 3.02Å; E22-N25 PolarHBondContact O-N 3.02Å; N25-S29 WeakPolarHBondContact O-CB 3.33Å; N25-S29 PolarHBondContact O-N 3.5Å
26	R	74.4	Confident	68.8	Low	144 Å²	144	112.3 Å²	112.3	54%	0.543	58%	0.582	S	S	.	*	H	α-helix	trans	-65.2	-39.1	174.7	-76.9	-173.9	-86.8	159.1	-13.2	112.6	E22 Q23 K30	E22-R26 PolarHBondContact OE1-NH2 2.94Å; E22-R26 IonicContact OE1-NH2 2.62Å; E22-R26 IonicContact OE1-NE 3.74Å; E22-R26 IonicContact OE1-CZ 3.48Å; E22-R26 PolarHBondContact O-N 2.96Å; E22-R26 PolarHBondContact O-NE 2.98Å; E22-R26 WeakPolarHBondContact O-CB 3.46Å; E22-R26 WeakPolarHBondContact O-CG 3.4Å; Q23-R26 PolarHBondContact O-N 3.41Å; R26-K30 PolarHBondContact O-N 3.13Å; R26-K30 VanDerWaalsContact O-N 3.16Å; R26-K30 WeakPolarHBondContact O-CB 3.4Å
27	Q	73.7	Confident	68.2	Low	96 Å²	96	116.8 Å²	116.8	45%	0.449	61%	0.613	S	S	.	*	H	α-helix	trans	-64.2	-52.5	175.6	-173.5	56.8	60.7	0	0	110.6	Q23 Q24 S29 K30 D31	Q23-Q27 PolarHBondContact O-N 3.42Å; Q24-Q27 PolarHBondContact O-N 2.97Å; Q27-S29 VanDerWaalsContact C-N 3.31Å; Q27-S29 PolarHBondContact O-N 2.91Å; Q27-K30 WeakPolarHBondContact O-CB 3.31Å; Q27-K30 PolarHBondContact O-N 3.22Å; Q27-D31 PolarHBondContact O-N 3.41Å; Q27-D31 VanDerWaalsContact O-CG 3.31Å; Q27-D31 PolarHBondContact NE2-OD2 2.87Å; Q27-D31 PolarHBondContact NE2-OD1 3.32Å; Q27-D31 WeakPolarHBondContact CG-OD2 3.38Å; Q27-D31 VanDerWaalsContact C-OD2 3.32Å; Q27-D31 VanDerWaalsContact NE2-CG 3.28Å
28	K	72.6	Confident	68.5	Low	131 Å²	131	118.5 Å²	118.5	57%	0.57	61%	0.61	S	S	*	*	H	α-helix	trans	-55	-44.2	177.1	-71.3	-176.9	-177.7	-159.9	0	113	Q24 K30 D31 Q32	Q24-K28 WeakPolarHBondContact O-CG 3.21Å; Q24-K28 PolarHBondContact O-N 3.19Å; K28-K30 VanDerWaalsContact C-N 3.29Å; K28-K30 PolarHBondContact O-N 3.42Å; K28-D31 PolarHBondContact O-N 3.31Å; K28-Q32 WeakPolarHBondContact O-CB 3.28Å; K28-Q32 WeakPolarHBondContact O-CG 3.12Å; K28-Q32 PolarHBondContact O-N 3.38Å
29	S	68.5	Low	68.4	Low	85 Å²	85	120.6 Å²	120.6	59%	0.594	61%	0.613	S	S	*	*	H	α-helix	trans	-64.4	-34.6	178.9	-177.7	0	0	0	0	112.5	N25 Q27 N33	N25-S29 WeakPolarHBondContact O-CB 3.33Å; N25-S29 PolarHBondContact O-N 3.5Å; Q27-S29 VanDerWaalsContact C-N 3.31Å; Q27-S29 PolarHBondContact O-N 2.91Å; S29-N33 PolarHBondContact O-N 2.99Å
30	K	70.7	Confident	68.3	Low	154 Å²	154	121.1 Å²	121.1	67%	0.67	62%	0.62	S	S	*	*	H	α-helix	trans	-72	-40.7	176.4	-169.4	175	-179.6	-178.1	0	112.2	R26 Q27 K28 N33 S34	R26-K30 PolarHBondContact O-N 3.13Å; R26-K30 VanDerWaalsContact O-N 3.16Å; R26-K30 WeakPolarHBondContact O-CB 3.4Å; Q27-K30 WeakPolarHBondContact O-CB 3.31Å; Q27-K30 PolarHBondContact O-N 3.22Å; K28-K30 VanDerWaalsContact C-N 3.29Å; K28-K30 PolarHBondContact O-N 3.42Å; K30-N33 PolarHBondContact O-N 2.89Å; K30-S34 PolarHBondContact O-N 2.89Å; K30-S34 VanDerWaalsContact O-N 3.16Å
31	D	63.3	Low	68.3	Low	77 Å²	77	122.1 Å²	122.1	41%	0.412	62%	0.624	S	S	.	*	H	α-helix	trans	-67.1	-37.4	178.2	-61.3	-48.4	0	0	0	111.7	Q27 K28 N33 S34 S35	Q27-D31 PolarHBondContact O-N 3.41Å; Q27-D31 VanDerWaalsContact O-CG 3.31Å; Q27-D31 PolarHBondContact NE2-OD2 2.87Å; Q27-D31 PolarHBondContact NE2-OD1 3.32Å; Q27-D31 WeakPolarHBondContact CG-OD2 3.38Å; Q27-D31 VanDerWaalsContact C-OD2 3.32Å; Q27-D31 VanDerWaalsContact NE2-CG 3.28Å; K28-D31 PolarHBondContact O-N 3.31Å; D31-N33 VanDerWaalsContact C-N 3.35Å; D31-N33 PolarHBondContact O-N 3.03Å; D31-S34 PolarHBondContact O-N 3.24Å; D31-S35 PolarHBondContact O-N 3.44Å; D31-S35 PolarHBondContact O-OG 3.15Å
32	Q	63.9	Low	67.8	Low	147 Å²	147	121.3 Å²	121.3	69%	0.687	62%	0.624	S	S	*	*	H	α-helix	trans	-68.1	-31.1	176	-68.5	-65.8	-77.5	0	0	113.2	K28	K28-Q32 WeakPolarHBondContact O-CB 3.28Å; K28-Q32 WeakPolarHBondContact O-CG 3.12Å; K28-Q32 PolarHBondContact O-N 3.38Å
33	N	59.8	Low	67	Low	128 Å²	128	122.4 Å²	122.4	68%	0.684	63%	0.632	S	S	*	*	H	α-helix	trans	-75.4	-27.5	174.1	-162.2	-58.8	0	0	0	111.8	S29 K30 D31 S35	S29-N33 PolarHBondContact O-N 2.99Å; K30-N33 PolarHBondContact O-N 2.89Å; D31-N33 VanDerWaalsContact C-N 3.35Å; D31-N33 PolarHBondContact O-N 3.03Å; N33-S35 VanDerWaalsContact C-N 3.3Å; N33-S35 PolarHBondContact O-N 3.19Å
34	S	61.8	Low	66.3	Low	90 Å²	90	124.8 Å²	124.8	63%	0.629	65%	0.648	S	S	*	*	H	α-helix	trans	-74.6	-14.8	179	-167.3	0	0	0	0	114.4	K30 D31 Q36	K30-S34 PolarHBondContact O-N 2.89Å; K30-S34 VanDerWaalsContact O-N 3.16Å; D31-S34 PolarHBondContact O-N 3.24Å; S34-Q36 VanDerWaalsContact C-N 3.33Å
35	S	62	Low	65.6	Low	98 Å²	98	125.4 Å²	125.4	69%	0.685	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	10.2	179.3	-55.8	0	0	0	0	114.2	D31 N33	D31-S35 PolarHBondContact O-N 3.44Å; D31-S35 PolarHBondContact O-OG 3.15Å; N33-S35 VanDerWaalsContact C-N 3.3Å; N33-S35 PolarHBondContact O-N 3.19Å
36	Q	59.9	Low	65.1	Low	178 Å²	178	127 Å²	127	83%	0.832	66%	0.663	S	S	*	*			trans	-115.2	21.7	-177.7	-143.7	-175	-76.7	0	0	114.3	S34	S34-Q36 VanDerWaalsContact C-N 3.33Å
37	T	50.4	Low	64.2	Low	196 Å²	196	125.5 Å²	125.5	100%	1.202	67%	0.674	S	S	*	*			trans	-122.5	0	165.3	-50.4	0	0	0	0	108.8

Retrieved 37 of 37 residues in 7.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).