Z4YN06_MOUSE Loading...

Acyl-Coenzyme A binding domain containing 5

AlphaFold DB , UniProt , Accession Z4YN06, Species MOUSE (Mus musculus, Mouse), Gene Acbd5, Length 52 aa.

						>Z4YN06_MOUSE|Z4YN06|Acbd5
MADTPSVYETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.3	Very low	80	Confident	230 Å²	230	123.2 Å²	123.2	100%	1.133	66%	0.659	S	S	*	*				0	112.2	0	-62	-60.1	-176.3	0	0	105.3	D3	M1-D3 PolarHBondContact O-N 3.13Å
2	A	52.1	Low	81.3	Confident	100 Å²	100	118.8 Å²	118.8	83%	0.826	63%	0.63	S	S	*	*			trans	-78	114.4	176.2	0	0	0	0	0	106.9	T4	A2-T4 PolarHBondContact O-N 3.46Å
3	D	66	Low	82.3	Confident	158 Å²	158	116.9 Å²	116.9	85%	0.845	62%	0.615	S	S	*	*			trans	-57.6	106.9	172.3	-67.4	-72.4	0	0	0	108.2	M1	M1-D3 PolarHBondContact O-N 3.13Å
4	T	76.7	Confident	83.3	Confident	132 Å²	132	112.4 Å²	112.4	81%	0.81	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-59.7	127	171.4	20.7	0	0	0	0	108.3	A2	A2-T4 PolarHBondContact O-N 3.46Å
5	P	79.1	Confident	84	Confident	68 Å²	68	108.5 Å²	108.5	44%	0.442	59%	0.592	S	S	.	*	P	Polyproline II helix	trans	-58.2	146.2	-180	22.4	-31.8	0	0	0	109.9	E9	P5-E9 HydrophobicContact CB-CB 4.32Å; P5-E9 HydrophobicContact CB-CG 4.09Å; P5-E9 WeakPolarHBondContact CB-OE2 3.47Å
6	S	91.9	Very high	84.7	Confident	57 Å²	57	103.4 Å²	103.4	40%	0.399	57%	0.565	S	S	.	*	P	Polyproline II helix	trans	-61.7	156.7	-178.8	76.1	0	0	0	0	110.7	Y8 E9 T10	S6-Y8 PolarHBondContact O-N 3.11Å; S6-Y8 VanDerWaalsContact O-N 3.15Å; S6-Y8 PolarHBondContact OG-N 2.98Å; S6-E9 PolarHBondContact N-OE2 3.17Å; S6-E9 PolarHBondContact O-N 3.07Å; S6-E9 VanDerWaalsContact O-N 3.13Å; S6-E9 WeakPolarHBondContact OG-CB 3.27Å; S6-E9 PolarHBondContact OG-N 3.4Å; S6-T10 PolarHBondContact O-N 2.66Å; S6-T10 PolarHBondContact O-OG1 2.63Å; S6-T10 VanDerWaalsContact O-OG1 3.12Å
7	V	94.7	Very high	85.3	Confident	91 Å²	91	104.9 Å²	104.9	55%	0.552	57%	0.565	S	S	*	*	H	α-helix	trans	-55.7	-33.6	174	175.3	0	0	0	0	111.1	R11	V7-R11 WeakPolarHBondContact O-CB 3.28Å; V7-R11 WeakPolarHBondContact O-CD 3.46Å; V7-R11 WeakPolarHBondContact O-CG 3.33Å; V7-R11 PolarHBondContact O-N 3.35Å; V7-R11 VanDerWaalsContact O-N 3.14Å
8	Y	93.8	Very high	85.7	Confident	182 Å²	182	104 Å²	104	71%	0.714	56%	0.564	S	S	*	*	H	α-helix	trans	-71.6	-42.9	178.1	-60.6	-67.7	0	0	0	112.5	S6 R11 F12	S6-Y8 PolarHBondContact O-N 3.11Å; S6-Y8 VanDerWaalsContact O-N 3.15Å; S6-Y8 PolarHBondContact OG-N 2.98Å; Y8-R11 PolarHBondContact O-N 3.02Å; Y8-F12 VanDerWaalsContact O-CB 3.26Å; Y8-F12 WeakPolarHBondContact O-CB 3.39Å; Y8-F12 PolarHBondContact O-N 3.45Å
9	E	93.4	Very high	85.9	Confident	95 Å²	95	100.9 Å²	100.9	44%	0.444	55%	0.546	S	S	.	.	H	α-helix	trans	-61.7	-47.1	176.6	-176.1	177	-179.7	0	0	111	P5 S6 R11 F12 E13	P5-E9 HydrophobicContact CB-CB 4.32Å; P5-E9 HydrophobicContact CB-CG 4.09Å; P5-E9 WeakPolarHBondContact CB-OE2 3.47Å; S6-E9 PolarHBondContact N-OE2 3.17Å; S6-E9 PolarHBondContact O-N 3.07Å; S6-E9 VanDerWaalsContact O-N 3.13Å; S6-E9 WeakPolarHBondContact OG-CB 3.27Å; S6-E9 PolarHBondContact OG-N 3.4Å; E9-R11 VanDerWaalsContact C-N 3.33Å; E9-R11 PolarHBondContact O-N 3.21Å; E9-F12 WeakPolarHBondContact O-CB 3.48Å; E9-F12 PolarHBondContact O-N 3.36Å; E9-F12 VanDerWaalsContact O-N 3.15Å; E9-E13 WeakPolarHBondContact O-CG 3.26Å; E9-E13 PolarHBondContact O-N 2.97Å
10	T	95	Very high	86.2	Confident	72 Å²	72	102.6 Å²	102.6	44%	0.442	55%	0.55	S	S	.	*	H	α-helix	trans	-59.7	-43.4	177.1	-56	0	0	0	0	111.7	S6 A14	S6-T10 PolarHBondContact O-N 2.66Å; S6-T10 PolarHBondContact O-OG1 2.63Å; S6-T10 VanDerWaalsContact O-OG1 3.12Å; T10-A14 WeakPolarHBondContact O-CB 3.44Å; T10-A14 PolarHBondContact O-N 3.3Å; T10-A14 VanDerWaalsContact O-N 3.12Å
11	R	95.5	Very high	86.4	Confident	170 Å²	170	102.2 Å²	102.2	64%	0.642	56%	0.556	S	S	*	*	H	α-helix	trans	-67.5	-38.8	177	-74.6	172.5	-178.9	-176.4	2.2	112.1	V7 Y8 E9 A14 A15	V7-R11 WeakPolarHBondContact O-CB 3.28Å; V7-R11 WeakPolarHBondContact O-CD 3.46Å; V7-R11 WeakPolarHBondContact O-CG 3.33Å; V7-R11 PolarHBondContact O-N 3.35Å; V7-R11 VanDerWaalsContact O-N 3.14Å; Y8-R11 PolarHBondContact O-N 3.02Å; E9-R11 VanDerWaalsContact C-N 3.33Å; E9-R11 PolarHBondContact O-N 3.21Å; R11-A14 PolarHBondContact O-N 3.43Å; R11-A15 WeakPolarHBondContact O-CB 3.2Å; R11-A15 PolarHBondContact O-N 3.46Å
12	F	95	Very high	88.6	Confident	71 Å²	71	93.8 Å²	93.8	31%	0.311	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-49.9	177.7	175	-100.5	0	0	0	110.9	Y8 E9 A14 A15 V16 Y42 A45 T46	Y8-F12 VanDerWaalsContact O-CB 3.26Å; Y8-F12 WeakPolarHBondContact O-CB 3.39Å; Y8-F12 PolarHBondContact O-N 3.45Å; E9-F12 WeakPolarHBondContact O-CB 3.48Å; E9-F12 PolarHBondContact O-N 3.36Å; E9-F12 VanDerWaalsContact O-N 3.15Å; F12-A14 VanDerWaalsContact C-N 3.32Å; F12-A14 PolarHBondContact O-N 3.37Å; F12-A15 PolarHBondContact O-N 3.04Å; F12-A15 VanDerWaalsContact O-N 3.16Å; F12-V16 HydrophobicContact CD1-CG2 4.28Å; F12-V16 HydrophobicContact CD2-CG2 4.43Å; F12-V16 HydrophobicContact CE1-CG2 3.9Å; F12-V16 HydrophobicContact CE2-CG2 4.06Å; F12-V16 HydrophobicContact CZ-CG2 3.79Å; F12-V16 WeakPolarHBondContact O-CG2 3.2Å; F12-V16 PolarHBondContact O-N 3.25Å; F12-Y42 HydrophobicContact CE1-CD2 4.47Å; F12-Y42 AromaticContact CZ-CD2 3.81Å; F12-Y42 HydrophobicContact CZ-CD2 3.81Å; F12-Y42 HydrophobicContact CZ-CE2 4.46Å; F12-A45 HydrophobicContact CE1-CB 4.18Å; F12-A45 HydrophobicContact CE2-CB 3.84Å; F12-A45 HydrophobicContact CZ-CB 3.6Å; F12-T46 HydrophobicContact CE1-CG2 4.49Å
13	E	94.6	Very high	90.4	Very high	94 Å²	94	93 Å²	93	44%	0.439	50%	0.502	S	S	.	.	H	α-helix	trans	-59.3	-42.4	177.1	-71.3	-172.9	169.8	0	0	112.5	E9 V16 K17	E9-E13 WeakPolarHBondContact O-CG 3.26Å; E9-E13 PolarHBondContact O-N 2.97Å; E13-V16 PolarHBondContact O-N 3.03Å; E13-K17 WeakPolarHBondContact O-CG 3.44Å; E13-K17 PolarHBondContact O-N 3.04Å
14	A	95.7	Very high	91	Very high	53 Å²	53	95 Å²	95	44%	0.438	50%	0.503	S	S	.	.	H	α-helix	trans	-61.6	-45	175.9	0	0	0	0	0	111.5	T10 R11 F12 K17 V18	T10-A14 WeakPolarHBondContact O-CB 3.44Å; T10-A14 PolarHBondContact O-N 3.3Å; T10-A14 VanDerWaalsContact O-N 3.12Å; R11-A14 PolarHBondContact O-N 3.43Å; F12-A14 VanDerWaalsContact C-N 3.32Å; F12-A14 PolarHBondContact O-N 3.37Å; A14-K17 PolarHBondContact O-N 2.94Å; A14-V18 WeakPolarHBondContact O-CG2 3.33Å; A14-V18 PolarHBondContact O-N 3.45Å
15	A	94.3	Very high	91.2	Very high	54 Å²	54	96.1 Å²	96.1	45%	0.446	50%	0.504	S	S	.	.	H	α-helix	trans	-63	-43.3	177.5	0	0	0	0	0	112.2	R11 F12 K17 V18 I19	R11-A15 WeakPolarHBondContact O-CB 3.2Å; R11-A15 PolarHBondContact O-N 3.46Å; F12-A15 PolarHBondContact O-N 3.04Å; F12-A15 VanDerWaalsContact O-N 3.16Å; A15-K17 VanDerWaalsContact C-N 3.34Å; A15-K17 PolarHBondContact O-N 3.3Å; A15-V18 PolarHBondContact O-N 2.92Å; A15-I19 WeakPolarHBondContact O-CG1 3.41Å; A15-I19 PolarHBondContact O-N 2.92Å
16	V	94.7	Very high	91.3	Very high	27 Å²	27	93.6 Å²	93.6	16%	0.164	49%	0.49	C	S	.	.	H	α-helix	trans	-58.6	-47	176	170.1	0	0	0	0	110.5	F12 E13 V18 I19 Q20 Y42	F12-V16 HydrophobicContact CD1-CG2 4.28Å; F12-V16 HydrophobicContact CD2-CG2 4.43Å; F12-V16 HydrophobicContact CE1-CG2 3.9Å; F12-V16 HydrophobicContact CE2-CG2 4.06Å; F12-V16 HydrophobicContact CZ-CG2 3.79Å; F12-V16 WeakPolarHBondContact O-CG2 3.2Å; F12-V16 PolarHBondContact O-N 3.25Å; E13-V16 PolarHBondContact O-N 3.03Å; V16-V18 VanDerWaalsContact C-N 3.35Å; V16-V18 PolarHBondContact O-N 3.48Å; V16-I19 PolarHBondContact O-N 2.82Å; V16-Q20 HydrophobicContact CG1-CG 4.34Å; V16-Q20 WeakPolarHBondContact O-CB 3.48Å; V16-Q20 WeakPolarHBondContact O-CG 3.42Å; V16-Q20 PolarHBondContact O-N 2.61Å; V16-Y42 HydrophobicContact CG1-CD2 4.39Å; V16-Y42 HydrophobicContact CG1-CE2 4.05Å; V16-Y42 HydrophobicContact CG2-CD2 3.83Å; V16-Y42 HydrophobicContact CG2-CE2 4.14Å
17	K	94.8	Very high	90.8	Very high	129 Å²	129	97.6 Å²	97.6	56%	0.561	52%	0.518	S	S	*	.	H	α-helix	trans	-59.6	-43.5	177.3	-75.8	172.3	179.2	166.4	0	112	E13 A14 A15 Q20 S21	E13-K17 WeakPolarHBondContact O-CG 3.44Å; E13-K17 PolarHBondContact O-N 3.04Å; A14-K17 PolarHBondContact O-N 2.94Å; A15-K17 VanDerWaalsContact C-N 3.34Å; A15-K17 PolarHBondContact O-N 3.3Å; K17-Q20 PolarHBondContact O-N 3.45Å; K17-S21 VanDerWaalsContact O-CB 3.27Å; K17-S21 WeakPolarHBondContact O-CB 3.4Å; K17-S21 PolarHBondContact O-N 3.31Å; K17-S21 PolarHBondContact O-OG 3.32Å
18	V	93.1	Very high	90.1	Very high	89 Å²	89	98.1 Å²	98.1	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-58.8	-52.7	176.5	170.2	0	0	0	0	110.7	A14 A15 V16 Q20 S21 L22	A14-V18 WeakPolarHBondContact O-CG2 3.33Å; A14-V18 PolarHBondContact O-N 3.45Å; A15-V18 PolarHBondContact O-N 2.92Å; V16-V18 VanDerWaalsContact C-N 3.35Å; V16-V18 PolarHBondContact O-N 3.48Å; V18-Q20 VanDerWaalsContact C-N 3.32Å; V18-Q20 PolarHBondContact O-N 3.41Å; V18-S21 PolarHBondContact O-N 3.45Å; V18-S21 VanDerWaalsContact O-N 3.11Å; V18-L22 WeakPolarHBondContact O-CG 3.16Å; V18-L22 PolarHBondContact O-N 2.98Å
19	I	90.4	Very high	89.7	Confident	45 Å²	45	95.8 Å²	95.8	23%	0.231	51%	0.509	C	S	.	.	H	α-helix	trans	-61.4	-40.7	-177.5	-63.3	-60.7	0	0	0	111.7	A15 V16 S21 L22 F38	A15-I19 WeakPolarHBondContact O-CG1 3.41Å; A15-I19 PolarHBondContact O-N 2.92Å; V16-I19 PolarHBondContact O-N 2.82Å; I19-S21 VanDerWaalsContact C-N 3.3Å; I19-S21 PolarHBondContact O-N 2.94Å; I19-L22 HydrophobicContact CD1-CD1 3.99Å; I19-L22 PolarHBondContact O-N 3.25Å; I19-F38 HydrophobicContact CD1-CD2 4.23Å; I19-F38 HydrophobicContact CD1-CE1 4.29Å; I19-F38 HydrophobicContact CD1-CE2 3.72Å; I19-F38 HydrophobicContact CD1-CZ 3.77Å; I19-F38 HydrophobicContact CG1-CE1 4.46Å; I19-F38 HydrophobicContact CG1-CE2 4.42Å; I19-F38 HydrophobicContact CG1-CZ 4.4Å
20	Q	90.1	Very high	89.3	Confident	134 Å²	134	92.7 Å²	92.7	63%	0.626	50%	0.497	S	S	*	.	H	α-helix	trans	-69.4	-27.1	177.5	-71.5	176.8	-11	0	0	113.5	V16 K17 V18 L22	V16-Q20 HydrophobicContact CG1-CG 4.34Å; V16-Q20 WeakPolarHBondContact O-CB 3.48Å; V16-Q20 WeakPolarHBondContact O-CG 3.42Å; V16-Q20 PolarHBondContact O-N 2.61Å; K17-Q20 PolarHBondContact O-N 3.45Å; V18-Q20 VanDerWaalsContact C-N 3.32Å; V18-Q20 PolarHBondContact O-N 3.41Å; Q20-L22 VanDerWaalsContact C-N 3.35Å
21	S	91.4	Very high	89.1	Confident	95 Å²	95	93.5 Å²	93.5	66%	0.664	50%	0.502	S	S	*	.	H	α-helix	trans	-85.9	-8.1	-179.8	-53.5	0	0	0	0	113	K17 V18 I19	K17-S21 VanDerWaalsContact O-CB 3.27Å; K17-S21 WeakPolarHBondContact O-CB 3.4Å; K17-S21 PolarHBondContact O-N 3.31Å; K17-S21 PolarHBondContact O-OG 3.32Å; V18-S21 PolarHBondContact O-N 3.45Å; V18-S21 VanDerWaalsContact O-N 3.11Å; I19-S21 VanDerWaalsContact C-N 3.3Å; I19-S21 PolarHBondContact O-N 2.94Å
22	L	89.1	Confident	88.9	Confident	53 Å²	53	92 Å²	92	28%	0.277	51%	0.506	S	S	.	.	S	Bend	trans	-64	127.9	-180	-74.5	172.7	0	0	0	110.6	V18 I19 Q20 F28	V18-L22 WeakPolarHBondContact O-CG 3.16Å; V18-L22 PolarHBondContact O-N 2.98Å; I19-L22 HydrophobicContact CD1-CD1 3.99Å; I19-L22 PolarHBondContact O-N 3.25Å; Q20-L22 VanDerWaalsContact C-N 3.35Å; L22-F28 HydrophobicContact CD1-CD1 3.75Å; L22-F28 HydrophobicContact CD1-CE1 4.05Å; L22-F28 HydrophobicContact CD2-CD1 4.23Å
23	P	88.3	Confident	88.8	Confident	85 Å²	85	94.4 Å²	94.4	55%	0.552	52%	0.519	S	S	*	.			trans	-67.6	139.6	175.2	25.7	-30.5	0	0	0	110.3	N25 G26	P23-N25 PolarHBondContact O-N 3.45Å; P23-N25 VanDerWaalsContact O-N 3.13Å; P23-G26 PolarHBondContact O-N 2.98Å; P23-G26 VanDerWaalsContact O-N 3.07Å
24	K	79.1	Confident	88.7	Confident	200 Å²	200	93 Å²	93	87%	0.87	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	-32.7	-179.8	-67.2	-174.2	178.1	-178.7	0	113.3
25	N	80.6	Confident	88.5	Confident	154 Å²	154	94.8 Å²	94.8	82%	0.824	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.6	44.6	178.1	-61.7	-31.2	0	0	0	111.1	P23	P23-N25 PolarHBondContact O-N 3.45Å; P23-N25 VanDerWaalsContact O-N 3.13Å
26	G	80.9	Confident	88.5	Confident	15 Å²	15	97.9 Å²	97.9	16%	0.155	52%	0.522	C	S	.	.	S	Bend	trans	-81.9	172.7	178.6	0	0	0	0	0	114.4	P23 F28 Q29	P23-G26 PolarHBondContact O-N 2.98Å; P23-G26 VanDerWaalsContact O-N 3.07Å; G26-F28 PolarHBondContact O-N 3.33Å; G26-Q29 PolarHBondContact O-NE2 3.21Å; G26-Q29 VanDerWaalsContact O-NE2 3.17Å
27	S	81.7	Confident	88.5	Confident	141 Å²	141	101.5 Å²	101.5	99%	0.986	54%	0.535	S	S	*	.	S	Bend	trans	-64.3	-22.1	169.1	53.6	0	0	0	0	113
28	F	81.3	Confident	88.4	Confident	102 Å²	102	99.2 Å²	99.2	45%	0.447	53%	0.525	S	S	.	.			trans	-114.5	115.3	174.3	-176.7	-105.8	0	0	0	109.9	L22 G26 P30 M34	L22-F28 HydrophobicContact CD1-CD1 3.75Å; L22-F28 HydrophobicContact CD1-CE1 4.05Å; L22-F28 HydrophobicContact CD2-CD1 4.23Å; G26-F28 PolarHBondContact O-N 3.33Å; F28-P30 HydrophobicContact CE1-CB 4.33Å; F28-P30 HydrophobicContact CE1-CG 4.4Å; F28-M34 HydrophobicContact CE1-CE 4.24Å; F28-M34 HydrophobicContact CE2-CE 4.24Å; F28-M34 HydrophobicContact CZ-CE 3.47Å; F28-M34 VanDerWaalsContact CZ-CE 3.47Å
29	Q	84.3	Confident	88.5	Confident	133 Å²	133	101.7 Å²	101.7	62%	0.621	53%	0.526	S	S	*	.			trans	-121.4	101.9	176.8	-70.7	175.6	36.8	0	0	108.1	G26 T31	G26-Q29 PolarHBondContact O-NE2 3.21Å; G26-Q29 VanDerWaalsContact O-NE2 3.17Å; Q29-T31 PolarHBondContact O-N 2.91Å
30	P	85.8	Confident	88.7	Confident	30 Å²	30	102.3 Å²	102.3	20%	0.195	54%	0.535	C	S	.	.			trans	-61.3	139.1	175.1	22.5	-30	0	0	0	110	F28 M34 M35	F28-P30 HydrophobicContact CE1-CB 4.33Å; F28-P30 HydrophobicContact CE1-CG 4.4Å; P30-M34 HydrophobicContact CB-CB 4.27Å; P30-M34 HydrophobicContact CB-CE 3.71Å; P30-M34 HydrophobicContact CB-CG 4.45Å; P30-M35 HydrophobicContact CB-CG 4.14Å; P30-M35 HydrophobicContact CB-SD 4.07Å; P30-M35 HydrophobicContact CG-CG 4.03Å; P30-M35 HydrophobicContact CG-SD 3.5Å; P30-M35 VanDerWaalsContact CG-SD 3.5Å
31	T	90.5	Very high	89	Confident	89 Å²	89	102.6 Å²	102.6	55%	0.546	53%	0.534	S	S	.	.			trans	-64.5	158.7	174	65.1	0	0	0	0	110.4	Q29 E33 M34 M35	Q29-T31 PolarHBondContact O-N 2.91Å; T31-E33 PolarHBondContact O-N 3.08Å; T31-M34 PolarHBondContact O-N 3.46Å; T31-M34 PolarHBondContact OG1-N 3.36Å; T31-M35 PolarHBondContact O-N 2.89Å
32	N	90.7	Very high	89.2	Confident	139 Å²	139	102.3 Å²	102.3	74%	0.743	52%	0.519	S	S	*	.	H	α-helix	trans	-54.3	-39.4	176.1	-70	-12.2	0	0	0	112.2	M34 M35 L36	N32-M34 VanDerWaalsContact C-N 3.33Å; N32-M34 PolarHBondContact O-N 2.96Å; N32-M35 PolarHBondContact O-N 3.16Å; N32-L36 WeakPolarHBondContact O-CG 3.36Å; N32-L36 PolarHBondContact O-N 3.49Å
33	E	93.9	Very high	89.6	Confident	121 Å²	121	102.5 Å²	102.5	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-61.3	-42.2	176.1	-168.9	-166.2	147.7	0	0	111.9	T31 L36 K37	T31-E33 PolarHBondContact O-N 3.08Å; E33-L36 PolarHBondContact O-N 3.12Å; E33-K37 WeakPolarHBondContact O-CG 3.47Å; E33-K37 PolarHBondContact O-N 2.98Å; E33-K37 VanDerWaalsContact O-N 3.08Å; E33-K37 VanDerWaalsContact OE1-CE 3.3Å; E33-K37 WeakPolarHBondContact OE1-CE 3.44Å; E33-K37 IonicContact OE1-NZ 2.61Å; E33-K37 PolarHBondContact OE1-NZ 2.95Å
34	M	91.9	Very high	89.9	Confident	66 Å²	66	103.3 Å²	103.3	33%	0.325	51%	0.514	S	S	.	.	H	α-helix	trans	-69.3	-37.5	178.7	-165.1	149.8	82	0	0	111.8	F28 P30 T31 N32 K37 F38	F28-M34 HydrophobicContact CE1-CE 4.24Å; F28-M34 HydrophobicContact CE2-CE 4.24Å; F28-M34 HydrophobicContact CZ-CE 3.47Å; F28-M34 VanDerWaalsContact CZ-CE 3.47Å; P30-M34 HydrophobicContact CB-CB 4.27Å; P30-M34 HydrophobicContact CB-CE 3.71Å; P30-M34 HydrophobicContact CB-CG 4.45Å; T31-M34 PolarHBondContact O-N 3.46Å; T31-M34 PolarHBondContact OG1-N 3.36Å; N32-M34 VanDerWaalsContact C-N 3.33Å; N32-M34 PolarHBondContact O-N 2.96Å; M34-K37 PolarHBondContact O-N 3.28Å; M34-F38 HydrophobicContact CE-CE2 4.39Å; M34-F38 HydrophobicContact CG-CD2 4.15Å; M34-F38 HydrophobicContact CG-CE2 3.59Å; M34-F38 HydrophobicContact CG-CZ 4.12Å; M34-F38 WeakPolarHBondContact O-CD2 3.39Å; M34-F38 PolarHBondContact O-N 3.42Å; M34-F38 HydrophobicContact SD-CE2 4.46Å
35	M	90.9	Very high	90.7	Very high	90 Å²	90	96.9 Å²	96.9	44%	0.443	50%	0.498	S	S	.	.	H	α-helix	trans	-61	-42.8	172.6	-71.3	-64	-71.9	0	0	112.1	P30 T31 N32 K37 F38 Y39	P30-M35 HydrophobicContact CB-CG 4.14Å; P30-M35 HydrophobicContact CB-SD 4.07Å; P30-M35 HydrophobicContact CG-CG 4.03Å; P30-M35 HydrophobicContact CG-SD 3.5Å; P30-M35 VanDerWaalsContact CG-SD 3.5Å; T31-M35 PolarHBondContact O-N 2.89Å; N32-M35 PolarHBondContact O-N 3.16Å; M35-K37 VanDerWaalsContact C-N 3.32Å; M35-K37 PolarHBondContact O-N 2.96Å; M35-F38 PolarHBondContact O-N 3.37Å; M35-Y39 WeakPolarHBondContact O-CB 3.32Å; M35-Y39 PolarHBondContact O-N 3.44Å
36	L	94.4	Very high	91.3	Very high	119 Å²	119	92.8 Å²	92.8	62%	0.623	48%	0.479	S	S	*	.	H	α-helix	trans	-63.2	-37.5	176.1	-71	171.8	0	0	0	112	N32 E33 Y39 S40	N32-L36 WeakPolarHBondContact O-CG 3.36Å; N32-L36 PolarHBondContact O-N 3.49Å; E33-L36 PolarHBondContact O-N 3.12Å; L36-Y39 PolarHBondContact O-N 2.96Å; L36-S40 PolarHBondContact O-N 3.36Å; L36-S40 PolarHBondContact O-OG 2.89Å
37	K	94.8	Very high	92	Very high	103 Å²	103	97.6 Å²	97.6	45%	0.448	50%	0.497	S	S	.	.	H	α-helix	trans	-65.6	-44.3	174.1	-72.3	174.8	-173.4	167.2	0	112.2	E33 M34 M35 Y39 S40 F41	E33-K37 WeakPolarHBondContact O-CG 3.47Å; E33-K37 PolarHBondContact O-N 2.98Å; E33-K37 VanDerWaalsContact O-N 3.08Å; E33-K37 VanDerWaalsContact OE1-CE 3.3Å; E33-K37 WeakPolarHBondContact OE1-CE 3.44Å; E33-K37 IonicContact OE1-NZ 2.61Å; E33-K37 PolarHBondContact OE1-NZ 2.95Å; M34-K37 PolarHBondContact O-N 3.28Å; M35-K37 VanDerWaalsContact C-N 3.32Å; M35-K37 PolarHBondContact O-N 2.96Å; K37-Y39 VanDerWaalsContact C-N 3.3Å; K37-Y39 PolarHBondContact O-N 3.16Å; K37-S40 PolarHBondContact O-N 3.4Å; K37-S40 PolarHBondContact O-OG 3.17Å; K37-F41 HydrophobicContact CB-CE2 4.38Å; K37-F41 WeakPolarHBondContact O-CD2 3.24Å; K37-F41 WeakPolarHBondContact O-CG 3.09Å; K37-F41 PolarHBondContact O-N 3.43Å; K37-F41 VanDerWaalsContact O-N 3.16Å
38	F	94.1	Very high	92.6	Very high	80 Å²	80	92.1 Å²	92.1	35%	0.351	46%	0.463	S	S	.	.	H	α-helix	trans	-61	-42.7	174.7	-71.2	-52.4	0	0	0	111.5	I19 M34 M35 Y42	I19-F38 HydrophobicContact CD1-CD2 4.23Å; I19-F38 HydrophobicContact CD1-CE1 4.29Å; I19-F38 HydrophobicContact CD1-CE2 3.72Å; I19-F38 HydrophobicContact CD1-CZ 3.77Å; I19-F38 HydrophobicContact CG1-CE1 4.46Å; I19-F38 HydrophobicContact CG1-CE2 4.42Å; I19-F38 HydrophobicContact CG1-CZ 4.4Å; M34-F38 HydrophobicContact CE-CE2 4.39Å; M34-F38 HydrophobicContact CG-CD2 4.15Å; M34-F38 HydrophobicContact CG-CE2 3.59Å; M34-F38 HydrophobicContact CG-CZ 4.12Å; M34-F38 WeakPolarHBondContact O-CD2 3.39Å; M34-F38 PolarHBondContact O-N 3.42Å; M34-F38 HydrophobicContact SD-CE2 4.46Å; M35-F38 PolarHBondContact O-N 3.37Å; F38-Y42 WeakPolarHBondContact O-CB 3.35Å; F38-Y42 PolarHBondContact O-N 3.4Å
39	Y	94.6	Very high	93.3	Very high	141 Å²	141	91.9 Å²	91.9	55%	0.553	47%	0.471	S	S	*	.	H	α-helix	trans	-61.8	-47.5	177.3	177.5	-102.7	0	0	0	112.2	M35 L36 K37 F41 Y42 K43	M35-Y39 WeakPolarHBondContact O-CB 3.32Å; M35-Y39 PolarHBondContact O-N 3.44Å; L36-Y39 PolarHBondContact O-N 2.96Å; K37-Y39 VanDerWaalsContact C-N 3.3Å; K37-Y39 PolarHBondContact O-N 3.16Å; Y39-F41 PolarHBondContact O-N 3.41Å; Y39-Y42 PolarHBondContact O-N 3.14Å; Y39-K43 HydrophobicContact CD1-CG 4.27Å; Y39-K43 HydrophobicContact CD2-CD 4.47Å; Y39-K43 HydrophobicContact CD2-CG 4.02Å; Y39-K43 HydrophobicContact CE1-CG 3.88Å; Y39-K43 HydrophobicContact CE2-CD 3.7Å; Y39-K43 HydrophobicContact CE2-CG 3.6Å; Y39-K43 HydrophobicContact CG-CG 4.35Å; Y39-K43 VanDerWaalsContact O-CG 3.26Å; Y39-K43 WeakPolarHBondContact O-CG 3.48Å; Y39-K43 PolarHBondContact O-N 2.69Å
40	S	95.4	Very high	93.8	Very high	59 Å²	59	91.2 Å²	91.2	41%	0.413	48%	0.48	S	S	.	.	H	α-helix	trans	-61.3	-45.5	-179	66.6	0	0	0	0	112	L36 K37 Q44	L36-S40 PolarHBondContact O-N 3.36Å; L36-S40 PolarHBondContact O-OG 2.89Å; K37-S40 PolarHBondContact O-N 3.4Å; K37-S40 PolarHBondContact O-OG 3.17Å; S40-Q44 WeakPolarHBondContact O-CB 3.3Å; S40-Q44 PolarHBondContact O-N 3.31Å
41	F	95.3	Very high	93.9	Very high	139 Å²	139	98.7 Å²	98.7	61%	0.61	51%	0.51	S	S	*	.	H	α-helix	trans	-68.2	-38.2	177.5	-63.8	-44.4	0	0	0	112.8	K37 Y39 Q44 A45	K37-F41 HydrophobicContact CB-CE2 4.38Å; K37-F41 WeakPolarHBondContact O-CD2 3.24Å; K37-F41 WeakPolarHBondContact O-CG 3.09Å; K37-F41 PolarHBondContact O-N 3.43Å; K37-F41 VanDerWaalsContact O-N 3.16Å; Y39-F41 PolarHBondContact O-N 3.41Å; F41-Q44 PolarHBondContact O-N 3.24Å; F41-A45 VanDerWaalsContact O-CB 3.32Å; F41-A45 WeakPolarHBondContact O-CB 3.47Å; F41-A45 PolarHBondContact O-N 2.96Å
42	Y	96.3	Very high	93	Very high	89 Å²	89	106.1 Å²	106.1	35%	0.349	55%	0.545	S	S	.	.	H	α-helix	trans	-59.4	-52.4	175.4	177	-100.8	0	0	0	110.8	F12 V16 F38 Y39 Q44 A45 T46	F12-Y42 HydrophobicContact CE1-CD2 4.47Å; F12-Y42 AromaticContact CZ-CD2 3.81Å; F12-Y42 HydrophobicContact CZ-CD2 3.81Å; F12-Y42 HydrophobicContact CZ-CE2 4.46Å; V16-Y42 HydrophobicContact CG1-CD2 4.39Å; V16-Y42 HydrophobicContact CG1-CE2 4.05Å; V16-Y42 HydrophobicContact CG2-CD2 3.83Å; V16-Y42 HydrophobicContact CG2-CE2 4.14Å; F38-Y42 WeakPolarHBondContact O-CB 3.35Å; F38-Y42 PolarHBondContact O-N 3.4Å; Y39-Y42 PolarHBondContact O-N 3.14Å; Y42-Q44 VanDerWaalsContact C-N 3.34Å; Y42-Q44 PolarHBondContact O-N 2.97Å; Y42-A45 PolarHBondContact O-N 3.15Å; Y42-A45 VanDerWaalsContact O-N 3.17Å; Y42-T46 HydrophobicContact CD2-CG2 4.21Å; Y42-T46 HydrophobicContact CE1-CG2 4.4Å; Y42-T46 HydrophobicContact CE2-CG2 3.83Å; Y42-T46 WeakPolarHBondContact O-CG2 3.48Å; Y42-T46 PolarHBondContact O-N 3.13Å; Y42-T46 PolarHBondContact O-OG1 2.83Å
43	K	96.5	Very high	93.1	Very high	57 Å²	57	104.5 Å²	104.5	25%	0.248	54%	0.535	C	S	.	.	H	α-helix	trans	-60.8	-42.5	178.9	-65.7	-68.2	-66.9	-171.3	0	112	Y39 A45 T46 E47 G48	Y39-K43 HydrophobicContact CD1-CG 4.27Å; Y39-K43 HydrophobicContact CD2-CD 4.47Å; Y39-K43 HydrophobicContact CD2-CG 4.02Å; Y39-K43 HydrophobicContact CE1-CG 3.88Å; Y39-K43 HydrophobicContact CE2-CD 3.7Å; Y39-K43 HydrophobicContact CE2-CG 3.6Å; Y39-K43 HydrophobicContact CG-CG 4.35Å; Y39-K43 VanDerWaalsContact O-CG 3.26Å; Y39-K43 WeakPolarHBondContact O-CG 3.48Å; Y39-K43 PolarHBondContact O-N 2.69Å; K43-A45 VanDerWaalsContact C-N 3.32Å; K43-A45 PolarHBondContact O-N 3.35Å; K43-T46 PolarHBondContact O-N 3.03Å; K43-E47 VanDerWaalsContact CE-CD 3.45Å; K43-E47 VanDerWaalsContact CE-OE1 3.28Å; K43-E47 WeakPolarHBondContact CE-OE1 3.26Å; K43-E47 WeakPolarHBondContact CE-OE2 3.45Å; K43-E47 IonicContact NZ-OE1 2.69Å; K43-E47 PolarHBondContact NZ-OE1 3.34Å; K43-E47 IonicContact NZ-OE2 2.66Å; K43-E47 PolarHBondContact NZ-OE2 3.12Å; K43-E47 WeakPolarHBondContact O-CA 3.35Å; K43-E47 WeakPolarHBondContact O-CB 3.42Å; K43-E47 PolarHBondContact O-N 3.14Å; K43-G48 PolarHBondContact O-N 3.39Å
44	Q	95.4	Very high	93.1	Very high	102 Å²	102	103.6 Å²	103.6	48%	0.477	53%	0.533	S	S	.	.	H	α-helix	trans	-61.8	-40.6	177.1	-173	68.6	13.7	0	0	112.1	S40 F41 Y42 G48	S40-Q44 WeakPolarHBondContact O-CB 3.3Å; S40-Q44 PolarHBondContact O-N 3.31Å; F41-Q44 PolarHBondContact O-N 3.24Å; Y42-Q44 VanDerWaalsContact C-N 3.34Å; Y42-Q44 PolarHBondContact O-N 2.97Å; Q44-G48 VanDerWaalsContact O-CA 3.24Å; Q44-G48 WeakPolarHBondContact O-CA 3.19Å; Q44-G48 PolarHBondContact O-N 2.98Å; Q44-G48 VanDerWaalsContact O-N 3.14Å; Q44-G48 PolarHBondContact OE1-O 3.15Å
45	A	94.7	Very high	93.2	Very high	65 Å²	65	105.7 Å²	105.7	54%	0.537	55%	0.545	S	S	.	.	H	α-helix	trans	-73.9	-32.3	-179.1	0	0	0	0	0	113	F12 F41 Y42 K43	F12-A45 HydrophobicContact CE1-CB 4.18Å; F12-A45 HydrophobicContact CE2-CB 3.84Å; F12-A45 HydrophobicContact CZ-CB 3.6Å; F41-A45 VanDerWaalsContact O-CB 3.32Å; F41-A45 WeakPolarHBondContact O-CB 3.47Å; F41-A45 PolarHBondContact O-N 2.96Å; Y42-A45 PolarHBondContact O-N 3.15Å; Y42-A45 VanDerWaalsContact O-N 3.17Å; K43-A45 VanDerWaalsContact C-N 3.32Å; K43-A45 PolarHBondContact O-N 3.35Å
46	T	94.8	Very high	93.3	Very high	68 Å²	68	106.6 Å²	106.6	42%	0.417	55%	0.551	S	S	.	*	H	α-helix	trans	-96	-32.6	-176.2	59.9	0	0	0	0	114.2	F12 Y42 K43	F12-T46 HydrophobicContact CE1-CG2 4.49Å; Y42-T46 HydrophobicContact CD2-CG2 4.21Å; Y42-T46 HydrophobicContact CE1-CG2 4.4Å; Y42-T46 HydrophobicContact CE2-CG2 3.83Å; Y42-T46 WeakPolarHBondContact O-CG2 3.48Å; Y42-T46 PolarHBondContact O-N 3.13Å; Y42-T46 PolarHBondContact O-OG1 2.83Å; K43-T46 PolarHBondContact O-N 3.03Å
47	E	95.5	Very high	93.2	Very high	117 Å²	117	105.9 Å²	105.9	55%	0.547	55%	0.546	S	S	.	.	H	α-helix	trans	-121.7	-9.8	-171.9	-67.8	170.8	-138.2	0	0	113.2	K43	K43-E47 VanDerWaalsContact CE-CD 3.45Å; K43-E47 VanDerWaalsContact CE-OE1 3.28Å; K43-E47 WeakPolarHBondContact CE-OE1 3.26Å; K43-E47 WeakPolarHBondContact CE-OE2 3.45Å; K43-E47 IonicContact NZ-OE1 2.69Å; K43-E47 PolarHBondContact NZ-OE1 3.34Å; K43-E47 IonicContact NZ-OE2 2.66Å; K43-E47 PolarHBondContact NZ-OE2 3.12Å; K43-E47 WeakPolarHBondContact O-CA 3.35Å; K43-E47 WeakPolarHBondContact O-CB 3.42Å; K43-E47 PolarHBondContact O-N 3.14Å
48	G	93.6	Very high	93.1	Very high	25 Å²	25	106.1 Å²	106.1	26%	0.258	55%	0.553	S	S	.	*			trans	78.1	-162	-176.4	0	0	0	0	0	113.1	K43 Q44	K43-G48 PolarHBondContact O-N 3.39Å; Q44-G48 VanDerWaalsContact O-CA 3.24Å; Q44-G48 WeakPolarHBondContact O-CA 3.19Å; Q44-G48 PolarHBondContact O-N 2.98Å; Q44-G48 VanDerWaalsContact O-N 3.14Å; Q44-G48 PolarHBondContact OE1-O 3.15Å
49	P	96.6	Very high	93.1	Very high	97 Å²	97	107.9 Å²	107.9	63%	0.63	57%	0.567	S	S	*	*	S	Bend	trans	-57.1	145.2	-177.8	-24.5	34.2	0	0	0	113.6	K51	P49-K51 PolarHBondContact O-N 3.46Å
50	C	94.3	Very high	92.9	Very high	120 Å²	120	105.4 Å²	105.4	81%	0.811	57%	0.569	S	S	*	*	P	Polyproline II helix	trans	-57.3	126	175.5	-168.7	0	0	0	0	110.8
51	K	87.9	Confident	92.7	Very high	186 Å²	186	109.3 Å²	109.3	81%	0.809	58%	0.582	S	S	*	*	P	Polyproline II helix	trans	-84.9	119.7	175.8	-61.6	179.1	-175.7	177.7	0	108	P49	P49-K51 PolarHBondContact O-N 3.46Å
52	L	71.9	Confident	92.5	Very high	246 Å²	246	106.5 Å²	106.5	100%	1.288	58%	0.579	S	S	*	*			trans	-70.7	0	175.2	-74.3	167.5	0	0	0	111.5

Retrieved 52 of 52 residues in 20.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).