Z4YN86_MOUSE Loading...

Translocase of inner mitochondrial membrane 22

AlphaFold DB , UniProt , Accession Z4YN86, Species MOUSE (Mus musculus, Mouse), Gene Timm22, Length 116 aa.

						>Z4YN86_MOUSE|Z4YN86|Timm22
MAATAPKAGGSAPEAAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGVPGKVGLEEQRHQWLHHWRSHRLPSWSKGRGHRLWRV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.3	Very low	39.3	Very low	249 Å²	249	127.2 Å²	127.2	100%	1.227	87%	0.867	S	S	*	*				0	140.3	0	-66.9	-173.5	179.1	0	0	108.1
2	A	34.8	Very low	39.7	Very low	92 Å²	92	122.3 Å²	122.3	76%	0.76	84%	0.843	S	S	*	*			cis	-161.9	139.5	-13	0	0	0	0	0	104.9
3	A	39.5	Very low	40.3	Very low	101 Å²	101	122.8 Å²	122.8	84%	0.835	84%	0.842	S	S	*	*			trans	-71.4	139.1	173.2	0	0	0	0	0	110.1
4	T	38.5	Very low	40.2	Very low	136 Å²	136	126.6 Å²	126.6	83%	0.834	84%	0.84	S	S	*	*			trans	-137.5	119.7	158.3	63.4	0	0	0	0	108.9
5	A	46.2	Very low	40.7	Very low	94 Å²	94	124.8 Å²	124.8	78%	0.777	84%	0.839	S	S	*	*			trans	-90.3	151.5	166.1	0	0	0	0	0	108.8
6	P	49.2	Very low	40.7	Very low	133 Å²	133	122.8 Å²	122.8	86%	0.864	83%	0.834	S	S	*	*			trans	-105.1	116.1	148.1	23	-8.3	0	0	0	109.4
7	K	41.1	Very low	41.1	Very low	213 Å²	213	120.1 Å²	120.1	93%	0.926	83%	0.832	S	S	*	*			trans	-98.6	112.9	162.6	-175.3	-176.2	-178.3	178.9	0	107.4
8	A	39.7	Very low	41.5	Very low	100 Å²	100	119.4 Å²	119.4	83%	0.826	83%	0.828	S	S	*	*			trans	-171.8	106	155.7	0	0	0	0	0	105
9	G	37	Very low	42.1	Very low	86 Å²	86	117.8 Å²	117.8	89%	0.887	82%	0.823	S	S	*	*				99.4	82.4	71.5	0	0	0	0	0	107
10	G	33.5	Very low	42.9	Very low	73 Å²	73	119.7 Å²	119.7	75%	0.753	82%	0.818	S	S	*	*			trans	-175.3	66.4	-179.2	0	0	0	0	0	107.7	A12	G10-A12 PolarHBondContact O-N 2.95Å
11	S	38.3	Very low	44.1	Very low	122 Å²	122	116.9 Å²	116.9	85%	0.853	80%	0.803	S	S	*	*			trans	-54.4	106.2	171.7	-159.5	0	0	0	0	107.2
12	A	44.5	Very low	46.2	Very low	69 Å²	69	110.6 Å²	110.6	57%	0.57	78%	0.781	S	S	*	*			trans	-51.7	141.9	153.9	0	0	0	0	0	106.1	G10 E14	G10-A12 PolarHBondContact O-N 2.95Å; A12-E14 PolarHBondContact O-N 2.76Å
13	P	48	Very low	48.3	Very low	128 Å²	128	111.3 Å²	111.3	83%	0.831	77%	0.771	S	S	*	*			trans	-62.4	103.5	160.3	27.8	-27	0	0	0	104.3	A15	P13-A15 PolarHBondContact O-N 3.29Å
14	E	39.1	Very low	50.8	Low	176 Å²	176	112.4 Å²	112.4	82%	0.822	76%	0.759	S	S	*	*			trans	-40.9	127.6	152.8	-82.5	-149.7	95.9	0	0	105.8	A12 A16	A12-E14 PolarHBondContact O-N 2.76Å; E14-A16 PolarHBondContact O-N 3.27Å
15	A	47.2	Very low	53.2	Low	100 Å²	100	114.4 Å²	114.4	83%	0.826	75%	0.753	S	S	*	*			trans	-54.8	95.4	168.3	0	0	0	0	0	106	P13 G17	P13-A15 PolarHBondContact O-N 3.29Å; A15-G17 PolarHBondContact O-N 3.15Å
16	A	41	Very low	55.3	Low	92 Å²	92	114 Å²	114	76%	0.76	74%	0.744	S	S	*	*			trans	-52.2	112.8	171.9	0	0	0	0	0	104.7	E14 S18	E14-A16 PolarHBondContact O-N 3.27Å; A16-S18 PolarHBondContact O-N 3.1Å
17	G	47.8	Very low	57.3	Low	77 Å²	77	111.9 Å²	111.9	79%	0.794	73%	0.725	S	S	*	*			trans	-49.8	107.5	176	0	0	0	0	0	107.3	A15 A19	A15-G17 PolarHBondContact O-N 3.15Å; G17-A19 PolarHBondContact O-N 3.29Å
18	S	48.1	Very low	59.6	Low	109 Å²	109	105.9 Å²	105.9	76%	0.762	70%	0.703	S	S	*	*			trans	-71.9	95.4	173.4	-163.4	0	0	0	0	105	A16 E20	A16-S18 PolarHBondContact O-N 3.1Å; S18-E20 PolarHBondContact O-N 3.43Å
19	A	52	Low	62	Low	89 Å²	89	106.1 Å²	106.1	74%	0.736	69%	0.69	S	S	*	*			trans	-43.5	125.9	155.3	0	0	0	0	0	106.7	G17 A21	G17-A19 PolarHBondContact O-N 3.29Å; A19-A21 VanDerWaalsContact C-N 3.32Å; A19-A21 PolarHBondContact O-N 2.97Å
20	E	59.2	Low	64.6	Low	155 Å²	155	106 Å²	106	72%	0.724	67%	0.666	S	S	*	*			trans	-63.7	89.5	-165.8	-156.5	-112.4	125	0	0	109.8	S18	S18-E20 PolarHBondContact O-N 3.43Å
21	A	67.3	Low	67.3	Low	61 Å²	61	108.7 Å²	108.7	50%	0.504	66%	0.655	S	S	.	*			trans	-66.7	141.9	168.9	0	0	0	0	0	107.7	A19 L23	A19-A21 VanDerWaalsContact C-N 3.32Å; A19-A21 PolarHBondContact O-N 2.97Å; A21-L23 PolarHBondContact O-N 3.32Å
22	P	77.9	Confident	69.7	Low	117 Å²	117	106.6 Å²	106.6	76%	0.76	63%	0.633	S	S	*	*			trans	-51.3	111.8	-176.8	-24.3	31.3	0	0	0	110.7	Q24	P22-Q24 PolarHBondContact O-N 3.42Å
23	L	80	Confident	71.9	Confident	106 Å²	106	109.1 Å²	109.1	56%	0.555	64%	0.641	S	S	*	*			trans	-67.6	102.5	-174	-72.3	170.7	0	0	0	110.2	A21 Y25	A21-L23 PolarHBondContact O-N 3.32Å; L23-Y25 PolarHBondContact O-N 3.5Å
24	Q	90.7	Very high	73.8	Confident	125 Å²	125	104 Å²	104	58%	0.584	61%	0.612	S	S	*	*			trans	-79.7	101.1	171.2	-66.9	-172.2	2.3	0	0	109.6	P22 S26 L27 L28	P22-Q24 PolarHBondContact O-N 3.42Å; Q24-S26 VanDerWaalsContact C-N 3.28Å; Q24-S26 PolarHBondContact O-N 3.43Å; Q24-L27 HydrophobicContact CB-CB 3.89Å; Q24-L27 WeakPolarHBondContact O-CB 3.21Å; Q24-L27 PolarHBondContact O-N 3.28Å; Q24-L27 VanDerWaalsContact O-N 3.13Å; Q24-L28 PolarHBondContact O-N 3.48Å
25	Y	90.3	Very high	76.1	Confident	177 Å²	177	103 Å²	103	69%	0.694	61%	0.612	S	S	*	*	H	α-helix	trans	-56	-39.2	-179.5	-71.7	-81.2	0	0	0	113.6	L23 L27 L28 L29	L23-Y25 PolarHBondContact O-N 3.5Å; Y25-L27 PolarHBondContact O-N 3.24Å; Y25-L28 PolarHBondContact O-N 3.04Å; Y25-L29 VanDerWaalsContact O-CG 3.3Å; Y25-L29 WeakPolarHBondContact O-CG 3.5Å; Y25-L29 PolarHBondContact O-N 3.13Å
26	S	89.6	Confident	78	Confident	85 Å²	85	104.3 Å²	104.3	59%	0.594	60%	0.599	S	S	*	*	H	α-helix	trans	-60.6	-45.6	177	50.8	0	0	0	0	111.8	Q24 L29 Q30	Q24-S26 VanDerWaalsContact C-N 3.28Å; Q24-S26 PolarHBondContact O-N 3.43Å; S26-L29 PolarHBondContact O-N 2.94Å; S26-Q30 PolarHBondContact O-N 2.88Å; S26-Q30 VanDerWaalsContact O-N 3.1Å
27	L	90.6	Very high	80.1	Confident	90 Å²	90	106.1 Å²	106.1	47%	0.471	59%	0.586	S	S	.	*	H	α-helix	trans	-64.1	-43.7	176.7	-169.3	66.7	0	0	0	110.7	Q24 Y25 L29 Q30 Y31	Q24-L27 HydrophobicContact CB-CB 3.89Å; Q24-L27 WeakPolarHBondContact O-CB 3.21Å; Q24-L27 PolarHBondContact O-N 3.28Å; Q24-L27 VanDerWaalsContact O-N 3.13Å; Y25-L27 PolarHBondContact O-N 3.24Å; L27-L29 PolarHBondContact O-N 2.91Å; L27-Q30 VanDerWaalsContact O-CB 3.3Å; L27-Q30 WeakPolarHBondContact O-CB 3.28Å; L27-Q30 PolarHBondContact O-N 2.84Å; L27-Q30 VanDerWaalsContact O-N 3.15Å; L27-Y31 HydrophobicContact CD1-CE2 4.09Å; L27-Y31 HydrophobicContact CG-CD2 4.4Å; L27-Y31 HydrophobicContact CG-CE2 4.13Å; L27-Y31 VanDerWaalsContact O-CD2 3.28Å; L27-Y31 WeakPolarHBondContact O-CD2 3.3Å; L27-Y31 PolarHBondContact O-N 3.14Å
28	L	90.6	Very high	81.9	Confident	87 Å²	87	109.3 Å²	109.3	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-59.4	-44.8	178.3	-150.9	88.4	0	0	0	111.9	Q24 Y25 Q30 Y31 L32	Q24-L28 PolarHBondContact O-N 3.48Å; Y25-L28 PolarHBondContact O-N 3.04Å; L28-Q30 VanDerWaalsContact C-N 3.3Å; L28-Q30 PolarHBondContact O-N 3.19Å; L28-Y31 PolarHBondContact O-N 2.8Å; L28-Y31 VanDerWaalsContact O-N 3.14Å; L28-L32 HydrophobicContact CD2-CD1 4.12Å; L28-L32 HydrophobicContact CG-CD1 4.31Å; L28-L32 WeakPolarHBondContact O-CG 3.3Å; L28-L32 PolarHBondContact O-N 2.92Å
29	L	90.1	Very high	83.5	Confident	105 Å²	105	110 Å²	110	55%	0.55	58%	0.583	S	S	.	*	H	α-helix	trans	-64.5	-34.7	177.1	-70.2	173.1	0	0	0	112.3	Y25 S26 L27 Y31 L32 V33 G34	Y25-L29 VanDerWaalsContact O-CG 3.3Å; Y25-L29 WeakPolarHBondContact O-CG 3.5Å; Y25-L29 PolarHBondContact O-N 3.13Å; S26-L29 PolarHBondContact O-N 2.94Å; L27-L29 PolarHBondContact O-N 2.91Å; L29-Y31 PolarHBondContact O-N 3.36Å; L29-L32 PolarHBondContact O-N 3.14Å; L29-V33 PolarHBondContact O-N 3.19Å; L29-G34 PolarHBondContact O-N 3.14Å; L29-G34 VanDerWaalsContact O-N 3.14Å
30	Q	90.6	Very high	84.8	Confident	84 Å²	84	113.5 Å²	113.5	39%	0.393	58%	0.577	S	S	.	*	H	α-helix	trans	-60.1	-32.9	174.6	-154.1	78.4	49.4	0	0	112.1	S26 L27 L28 G34 K36	S26-Q30 PolarHBondContact O-N 2.88Å; S26-Q30 VanDerWaalsContact O-N 3.1Å; L27-Q30 VanDerWaalsContact O-CB 3.3Å; L27-Q30 WeakPolarHBondContact O-CB 3.28Å; L27-Q30 PolarHBondContact O-N 2.84Å; L27-Q30 VanDerWaalsContact O-N 3.15Å; L28-Q30 VanDerWaalsContact C-N 3.3Å; L28-Q30 PolarHBondContact O-N 3.19Å; Q30-G34 CarbonylContact O-C 3.16Å; Q30-G34 WeakPolarHBondContact O-CA 3.16Å; Q30-G34 PolarHBondContact O-N 2.68Å; Q30-K36 HydrophobicContact CG-CB 4.32Å; Q30-K36 HydrophobicContact CG-CG 3.87Å; Q30-K36 PolarHBondContact O-N 2.91Å
31	Y	90.9	Very high	85.6	Confident	129 Å²	129	113.6 Å²	113.6	51%	0.506	58%	0.581	S	S	.	*	H	α-helix	trans	-85.6	-25.8	176.7	-78.6	-79.3	0	0	0	113.9	L27 L28 L29 K36 R37	L27-Y31 HydrophobicContact CD1-CE2 4.09Å; L27-Y31 HydrophobicContact CG-CD2 4.4Å; L27-Y31 HydrophobicContact CG-CE2 4.13Å; L27-Y31 VanDerWaalsContact O-CD2 3.28Å; L27-Y31 WeakPolarHBondContact O-CD2 3.3Å; L27-Y31 PolarHBondContact O-N 3.14Å; L28-Y31 PolarHBondContact O-N 2.8Å; L28-Y31 VanDerWaalsContact O-N 3.14Å; L29-Y31 PolarHBondContact O-N 3.36Å; Y31-K36 HydrophobicContact CD1-CB 3.73Å; Y31-K36 WeakPolarHBondContact CD1-O 3.42Å; Y31-K36 HydrophobicContact CE1-CB 3.75Å; Y31-K36 HydrophobicContact CG-CB 4.14Å; Y31-R37 WeakPolarHBondContact O-CA 3.37Å
32	L	89.1	Confident	85.8	Confident	78 Å²	78	115.1 Å²	115.1	41%	0.408	58%	0.581	S	S	.	*	H	α-helix	trans	-85.3	-43.7	-179.8	-68.5	172.3	0	0	0	112.9	L28 L29	L28-L32 HydrophobicContact CD2-CD1 4.12Å; L28-L32 HydrophobicContact CG-CD1 4.31Å; L28-L32 WeakPolarHBondContact O-CG 3.3Å; L28-L32 PolarHBondContact O-N 2.92Å; L29-L32 PolarHBondContact O-N 3.14Å
33	V	89.4	Confident	85.7	Confident	121 Å²	121	114.8 Å²	114.8	73%	0.733	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.5	-23.3	-173.1	-173.5	0	0	0	0	112.6	L29	L29-V33 PolarHBondContact O-N 3.19Å
34	G	88.5	Confident	85.1	Confident	21 Å²	21	115.5 Å²	115.5	22%	0.216	58%	0.58	C	S	.	*	S	Bend	trans	-82.7	-171.3	-178.7	0	0	0	0	0	115	L29 Q30 K36 R37	L29-G34 PolarHBondContact O-N 3.14Å; L29-G34 VanDerWaalsContact O-N 3.14Å; Q30-G34 CarbonylContact O-C 3.16Å; Q30-G34 WeakPolarHBondContact O-CA 3.16Å; Q30-G34 PolarHBondContact O-N 2.68Å; G34-K36 PolarHBondContact O-N 3.29Å; G34-K36 VanDerWaalsContact O-N 3.14Å; G34-R37 WeakPolarHBondContact O-CB 3.4Å; G34-R37 PolarHBondContact O-N 2.88Å
35	D	87.8	Confident	84.1	Confident	154 Å²	154	112.5 Å²	112.5	82%	0.824	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	-15.7	-172.4	-48.3	-56.9	0	0	0	114.5	R37	D35-R37 PolarHBondContact O-N 3.21Å
36	K	87.2	Confident	83.2	Confident	128 Å²	128	108.6 Å²	108.6	56%	0.557	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	2.2	176.3	-59.8	-65	-176.3	179.6	0	112.2	Q30 Y31 G34 Q38	Q30-K36 HydrophobicContact CG-CB 4.32Å; Q30-K36 HydrophobicContact CG-CG 3.87Å; Q30-K36 PolarHBondContact O-N 2.91Å; Y31-K36 HydrophobicContact CD1-CB 3.73Å; Y31-K36 WeakPolarHBondContact CD1-O 3.42Å; Y31-K36 HydrophobicContact CE1-CB 3.75Å; Y31-K36 HydrophobicContact CG-CB 4.14Å; G34-K36 PolarHBondContact O-N 3.29Å; G34-K36 VanDerWaalsContact O-N 3.14Å; K36-Q38 PolarHBondContact O-N 3.04Å
37	R	85.4	Confident	82.3	Confident	130 Å²	130	110.6 Å²	110.6	49%	0.491	58%	0.584	S	S	.	*	P	Polyproline II helix	trans	-62.4	126.6	175.5	179.5	-179.5	172.9	-170.3	0.2	110.7	Y31 G34 D35	Y31-R37 WeakPolarHBondContact O-CA 3.37Å; G34-R37 WeakPolarHBondContact O-CB 3.4Å; G34-R37 PolarHBondContact O-N 2.88Å; D35-R37 PolarHBondContact O-N 3.21Å
38	Q	84.3	Confident	81.5	Confident	144 Å²	144	109.6 Å²	109.6	67%	0.673	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-79.6	139.9	167.6	-68.5	-67.9	-18.1	0	0	110	K36 R40	K36-Q38 PolarHBondContact O-N 3.04Å; Q38-R40 PolarHBondContact O-N 3.13Å; Q38-R40 VanDerWaalsContact O-N 3.13Å
39	P	81.1	Confident	81	Confident	124 Å²	124	108.7 Å²	108.7	81%	0.805	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-54.3	120.4	170.9	-23.2	33.3	0	0	0	109.7
40	R	79.3	Confident	80	Confident	163 Å²	163	111.4 Å²	111.4	62%	0.615	62%	0.621	S	S	*	*	P	Polyproline II helix	trans	-102.9	128	176.4	-70.1	-166.7	177.1	158.2	0.4	108.9	Q38 L42	Q38-R40 PolarHBondContact O-N 3.13Å; Q38-R40 VanDerWaalsContact O-N 3.13Å; R40-L42 HydrophobicContact CB-CG 4.39Å; R40-L42 PolarHBondContact O-N 3.28Å
41	L	77.5	Confident	79	Confident	157 Å²	157	112 Å²	112	82%	0.822	63%	0.633	S	S	*	*			trans	-72.2	108.2	164.2	-173.4	68.3	0	0	0	106.9
42	L	70.9	Confident	78	Confident	93 Å²	93	110.9 Å²	110.9	49%	0.487	64%	0.643	S	S	.	*			trans	-102.3	114.1	176.6	-69.7	166.2	0	0	0	107.2	R40 L47	R40-L42 HydrophobicContact CB-CG 4.39Å; R40-L42 PolarHBondContact O-N 3.28Å; L42-L47 HydrophobicContact CB-CD1 4.48Å; L42-L47 HydrophobicContact CD1-CD1 4.44Å; L42-L47 HydrophobicContact CD2-CD2 4.47Å
43	E	75.5	Confident	77.3	Confident	110 Å²	110	111.6 Å²	111.6	51%	0.514	65%	0.652	S	S	.	*			trans	-66.9	126.6	172.9	-68.9	-59.1	113.6	0	0	108.6	G45 S46	E43-G45 PolarHBondContact O-N 3.25Å; E43-S46 WeakPolarHBondContact O-CB 3.44Å; E43-S46 PolarHBondContact O-N 3.46Å
44	P	67.7	Low	76.6	Confident	121 Å²	121	111 Å²	111	79%	0.786	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	-16.6	-173.6	22.9	-32.6	0	0	0	113.7
45	G	69.4	Low	75.9	Confident	62 Å²	62	115 Å²	115	64%	0.639	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	-11	173	0	0	0	0	0	115	E43	E43-G45 PolarHBondContact O-N 3.25Å
46	S	71.2	Confident	75.6	Confident	95 Å²	95	110.2 Å²	110.2	66%	0.664	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-15.3	-175.3	-60.3	0	0	0	0	114	E43 G48	E43-S46 WeakPolarHBondContact O-CB 3.44Å; E43-S46 PolarHBondContact O-N 3.46Å; S46-G48 PolarHBondContact O-N 3.03Å
47	L	71.4	Confident	75.3	Confident	126 Å²	126	111 Å²	111	66%	0.66	66%	0.656	S	S	*	*	S	Bend	trans	-85.1	13.7	-175	-71.1	173.2	0	0	0	114.6	L42	L42-L47 HydrophobicContact CB-CD1 4.48Å; L42-L47 HydrophobicContact CD1-CD1 4.44Å; L42-L47 HydrophobicContact CD2-CD2 4.47Å
48	G	73.6	Confident	75.2	Confident	69 Å²	69	110.1 Å²	110.1	71%	0.711	66%	0.658	S	S	*	*	S	Bend	trans	73.9	150.9	176.9	0	0	0	0	0	113.7	S46	S46-G48 PolarHBondContact O-N 3.03Å
49	G	79.8	Confident	75.3	Confident	69 Å²	69	107.4 Å²	107.4	71%	0.711	65%	0.645	S	S	*	*	S	Bend	trans	117.6	175.3	-175.8	0	0	0	0	0	113
50	I	68.5	Low	75.5	Confident	162 Å²	162	106.7 Å²	106.7	83%	0.831	63%	0.629	S	S	*	*	S	Bend	trans	-65.2	121.5	166.9	-58.4	-60.1	0	0	0	106.4	S52	I50-S52 PolarHBondContact O-N 2.9Å; I50-S52 VanDerWaalsContact O-N 3.08Å
51	P	71.3	Confident	75.8	Confident	97 Å²	97	104 Å²	104	63%	0.63	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-55.4	124	-178.9	23.5	-33.1	0	0	0	107.9	P53	P51-P53 VanDerWaalsContact O-N 3.17Å
52	S	69.8	Low	76.2	Confident	104 Å²	104	101.3 Å²	101.3	73%	0.727	61%	0.611	S	S	*	*	P	Polyproline II helix	trans	-53.2	128.3	175.7	177.2	0	0	0	0	107.3	I50 A54	I50-S52 PolarHBondContact O-N 2.9Å; I50-S52 VanDerWaalsContact O-N 3.08Å; S52-A54 PolarHBondContact O-N 3.5Å
53	P	74.1	Confident	77	Confident	93 Å²	93	99.7 Å²	99.7	60%	0.604	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-54	137.5	177.2	21.7	-31.6	0	0	0	108.6	P51 K55	P51-P53 VanDerWaalsContact O-N 3.17Å; P53-K55 PolarHBondContact O-N 3.12Å
54	A	74	Confident	77.5	Confident	110 Å²	110	102 Å²	102	91%	0.909	60%	0.604	S	S	*	*			trans	-62.6	99	-179.7	0	0	0	0	0	108.7	S52	S52-A54 PolarHBondContact O-N 3.5Å
55	K	74.9	Confident	78.4	Confident	103 Å²	103	98.5 Å²	98.5	45%	0.448	59%	0.586	S	S	.	*			trans	-92.9	131.9	171.3	-69.9	-167.5	178	-177.1	0	108.5	P53 E63	P53-K55 PolarHBondContact O-N 3.12Å; K55-E63 WeakPolarHBondContact CE-OE1 3.49Å; K55-E63 IonicContact NZ-OE1 2.79Å; K55-E63 PolarHBondContact NZ-OE1 3.32Å; K55-E63 IonicContact NZ-OE2 2.75Å; K55-E63 PolarHBondContact NZ-OE2 3.46Å
56	S	80.8	Confident	79.3	Confident	54 Å²	54	100.6 Å²	100.6	38%	0.378	58%	0.58	S	S	.	*			trans	-66.1	155.8	171.9	91.2	0	0	0	0	110.2	E58 Q59 K60	S56-E58 WeakPolarHBondContact CB-OE2 3.42Å; S56-E58 PolarHBondContact O-N 3.29Å; S56-E58 PolarHBondContact OG-N 3.3Å; S56-E58 PolarHBondContact OG-OE2 2.66Å; S56-Q59 PolarHBondContact O-N 3.49Å; S56-Q59 PolarHBondContact OG-N 3.35Å; S56-Q59 VanDerWaalsContact OG-N 3.13Å; S56-K60 PolarHBondContact O-N 3.35Å; S56-K60 VanDerWaalsContact O-N 3.09Å
57	E	80.9	Confident	79.8	Confident	144 Å²	144	102.7 Å²	102.7	67%	0.673	58%	0.579	S	S	*	*	H	α-helix	trans	-61.7	-36.2	178.5	-177.6	167.5	-171.9	0	0	111	K60 M61	E57-K60 WeakPolarHBondContact O-CB 3.33Å; E57-K60 PolarHBondContact O-N 3.41Å; E57-M61 WeakPolarHBondContact O-CG 3.49Å; E57-M61 PolarHBondContact O-N 3.5Å
58	E	83.9	Confident	80.5	Confident	112 Å²	112	98.1 Å²	98.1	52%	0.523	56%	0.558	S	S	.	*	H	α-helix	trans	-62.5	-46.6	176.2	-53.2	74.3	-156.3	0	0	111	S56 K60 M61 I62	S56-E58 WeakPolarHBondContact CB-OE2 3.42Å; S56-E58 PolarHBondContact O-N 3.29Å; S56-E58 PolarHBondContact OG-N 3.3Å; S56-E58 PolarHBondContact OG-OE2 2.66Å; E58-K60 VanDerWaalsContact C-N 3.3Å; E58-K60 PolarHBondContact O-N 2.98Å; E58-M61 WeakPolarHBondContact O-CB 3.46Å; E58-M61 PolarHBondContact O-N 3.12Å; E58-M61 VanDerWaalsContact O-N 3.11Å; E58-I62 VanDerWaalsContact O-CG1 3.26Å; E58-I62 WeakPolarHBondContact O-CG1 3.08Å; E58-I62 PolarHBondContact O-N 3.47Å
59	Q	85.7	Confident	80.8	Confident	87 Å²	87	97.7 Å²	97.7	41%	0.407	54%	0.544	S	S	.	.	H	α-helix	trans	-61.7	-40.7	177.8	-176.2	177.7	-17.8	0	0	111.4	S56 M61 I62 E63	S56-Q59 PolarHBondContact O-N 3.49Å; S56-Q59 PolarHBondContact OG-N 3.35Å; S56-Q59 VanDerWaalsContact OG-N 3.13Å; Q59-M61 VanDerWaalsContact C-N 3.3Å; Q59-M61 PolarHBondContact O-N 2.94Å; Q59-I62 PolarHBondContact O-N 3.48Å; Q59-E63 HydrophobicContact CG-CG 4.49Å; Q59-E63 PolarHBondContact NE2-OE1 2.84Å; Q59-E63 VanDerWaalsContact NE2-OE1 3.08Å; Q59-E63 WeakPolarHBondContact O-CG 3.4Å; Q59-E63 PolarHBondContact O-N 2.97Å
60	K	85.4	Confident	80.9	Confident	109 Å²	109	96.4 Å²	96.4	47%	0.474	53%	0.527	S	S	.	.	H	α-helix	trans	-63.3	-36.6	175.3	-175.9	178.3	-179.8	178.6	0	112.1	S56 E57 E58 R64	S56-K60 PolarHBondContact O-N 3.35Å; S56-K60 VanDerWaalsContact O-N 3.09Å; E57-K60 WeakPolarHBondContact O-CB 3.33Å; E57-K60 PolarHBondContact O-N 3.41Å; E58-K60 VanDerWaalsContact C-N 3.3Å; E58-K60 PolarHBondContact O-N 2.98Å; K60-R64 WeakPolarHBondContact O-CD 3.45Å; K60-R64 VanDerWaalsContact O-CG 3.23Å; K60-R64 WeakPolarHBondContact O-CG 3.46Å; K60-R64 PolarHBondContact O-N 3.48Å
61	M	84.4	Confident	81.5	Confident	107 Å²	107	93 Å²	93	53%	0.527	51%	0.506	S	S	.	.	H	α-helix	trans	-68.6	-41.1	174.3	-71.4	-167.2	-67.8	0	0	111.9	E57 E58 Q59 R64 A65	E57-M61 WeakPolarHBondContact O-CG 3.49Å; E57-M61 PolarHBondContact O-N 3.5Å; E58-M61 WeakPolarHBondContact O-CB 3.46Å; E58-M61 PolarHBondContact O-N 3.12Å; E58-M61 VanDerWaalsContact O-N 3.11Å; Q59-M61 VanDerWaalsContact C-N 3.3Å; Q59-M61 PolarHBondContact O-N 2.94Å; M61-R64 PolarHBondContact O-N 2.99Å; M61-A65 WeakPolarHBondContact O-CB 3.23Å; M61-A65 PolarHBondContact O-N 3.26Å
62	I	87.3	Confident	82.2	Confident	101 Å²	101	94 Å²	94	52%	0.518	50%	0.5	S	S	.	.	H	α-helix	trans	-64.2	-47.4	178.1	-67.6	162.4	0	0	0	110.8	E58 Q59 R64 A65 M66	E58-I62 VanDerWaalsContact O-CG1 3.26Å; E58-I62 WeakPolarHBondContact O-CG1 3.08Å; E58-I62 PolarHBondContact O-N 3.47Å; Q59-I62 PolarHBondContact O-N 3.48Å; I62-R64 VanDerWaalsContact C-N 3.29Å; I62-R64 PolarHBondContact O-N 3.04Å; I62-A65 WeakPolarHBondContact O-CB 3.26Å; I62-A65 PolarHBondContact O-N 2.66Å; I62-M66 HydrophobicContact CG2-CG 4.32Å; I62-M66 HydrophobicContact CG2-SD 3.98Å; I62-M66 WeakPolarHBondContact O-CG 3.18Å; I62-M66 PolarHBondContact O-N 3.04Å
63	E	86.8	Confident	82.7	Confident	58 Å²	58	90.3 Å²	90.3	27%	0.271	48%	0.476	S	S	.	.	H	α-helix	trans	-56.6	-44.8	176.8	-73.7	175.2	-173.4	0	0	111	K55 Q59 A65 M66 E67	K55-E63 WeakPolarHBondContact CE-OE1 3.49Å; K55-E63 IonicContact NZ-OE1 2.79Å; K55-E63 PolarHBondContact NZ-OE1 3.32Å; K55-E63 IonicContact NZ-OE2 2.75Å; K55-E63 PolarHBondContact NZ-OE2 3.46Å; Q59-E63 HydrophobicContact CG-CG 4.49Å; Q59-E63 PolarHBondContact NE2-OE1 2.84Å; Q59-E63 VanDerWaalsContact NE2-OE1 3.08Å; Q59-E63 WeakPolarHBondContact O-CG 3.4Å; Q59-E63 PolarHBondContact O-N 2.97Å; E63-A65 VanDerWaalsContact C-N 3.34Å; E63-A65 PolarHBondContact O-N 2.92Å; E63-M66 PolarHBondContact O-N 3.39Å; E63-E67 WeakPolarHBondContact O-CG 3.14Å; E63-E67 PolarHBondContact O-N 3.34Å
64	R	85.9	Confident	83.2	Confident	158 Å²	158	90.2 Å²	90.2	60%	0.596	47%	0.473	S	S	*	.	H	α-helix	trans	-63.3	-37.8	175.1	-72.9	171.6	173.2	-169.5	-5.4	113.1	K60 M61 I62 S68	K60-R64 WeakPolarHBondContact O-CD 3.45Å; K60-R64 VanDerWaalsContact O-CG 3.23Å; K60-R64 WeakPolarHBondContact O-CG 3.46Å; K60-R64 PolarHBondContact O-N 3.48Å; M61-R64 PolarHBondContact O-N 2.99Å; I62-R64 VanDerWaalsContact C-N 3.29Å; I62-R64 PolarHBondContact O-N 3.04Å; R64-S68 PolarHBondContact O-N 3.26Å
65	A	87.4	Confident	83.4	Confident	49 Å²	49	89.7 Å²	89.7	41%	0.405	46%	0.455	S	S	.	.	H	α-helix	trans	-67.9	-41.8	177.4	0	0	0	0	0	111.1	M61 I62 E63 E67 S68 F71	M61-A65 WeakPolarHBondContact O-CB 3.23Å; M61-A65 PolarHBondContact O-N 3.26Å; I62-A65 WeakPolarHBondContact O-CB 3.26Å; I62-A65 PolarHBondContact O-N 2.66Å; E63-A65 VanDerWaalsContact C-N 3.34Å; E63-A65 PolarHBondContact O-N 2.92Å; A65-E67 VanDerWaalsContact C-N 3.35Å; A65-E67 PolarHBondContact O-N 3.42Å; A65-S68 WeakPolarHBondContact O-CB 3.07Å; A65-S68 PolarHBondContact O-N 2.89Å; A65-S68 VanDerWaalsContact O-N 3.1Å; A65-S68 PolarHBondContact O-OG 3.25Å; A65-F71 VanDerWaalsContact O-CB 3.25Å; A65-F71 WeakPolarHBondContact O-CB 3.16Å
66	M	87.6	Confident	83.5	Confident	105 Å²	105	87.3 Å²	87.3	52%	0.517	45%	0.454	S	S	.	.	H	α-helix	trans	-64.8	-37.2	177	-71.9	179.3	63.1	0	0	112.5	I62 E63 S68 F71	I62-M66 HydrophobicContact CG2-CG 4.32Å; I62-M66 HydrophobicContact CG2-SD 3.98Å; I62-M66 WeakPolarHBondContact O-CG 3.18Å; I62-M66 PolarHBondContact O-N 3.04Å; E63-M66 PolarHBondContact O-N 3.39Å; M66-S68 PolarHBondContact O-N 2.87Å; M66-F71 HydrophobicContact CB-CD1 4.49Å; M66-F71 HydrophobicContact CB-CE1 4.48Å; M66-F71 HydrophobicContact CG-CE1 4.32Å; M66-F71 WeakPolarHBondContact O-CD1 3.45Å
67	E	82.9	Confident	83	Confident	139 Å²	139	88.4 Å²	88.4	65%	0.65	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.7	-12.5	175.4	-71.1	174.4	-177.8	0	0	113.1	E63 A65	E63-E67 WeakPolarHBondContact O-CG 3.14Å; E63-E67 PolarHBondContact O-N 3.34Å; A65-E67 VanDerWaalsContact C-N 3.35Å; A65-E67 PolarHBondContact O-N 3.42Å
68	S	84.4	Confident	82.6	Confident	31 Å²	31	87.1 Å²	87.1	22%	0.217	46%	0.463	C	S	.	.	S	Bend	trans	-69.6	140.2	-175.7	84.3	0	0	0	0	112.5	R64 A65 M66 A70 F71 K72	R64-S68 PolarHBondContact O-N 3.26Å; A65-S68 WeakPolarHBondContact O-CB 3.07Å; A65-S68 PolarHBondContact O-N 2.89Å; A65-S68 VanDerWaalsContact O-N 3.1Å; A65-S68 PolarHBondContact O-OG 3.25Å; M66-S68 PolarHBondContact O-N 2.87Å; S68-A70 PolarHBondContact O-N 3.42Å; S68-A70 VanDerWaalsContact O-N 3.14Å; S68-F71 PolarHBondContact O-N 3.09Å; S68-F71 PolarHBondContact OG-N 3.11Å; S68-K72 PolarHBondContact O-N 3.31Å
69	C	80.1	Confident	81.6	Confident	59 Å²	59	84.6 Å²	84.6	40%	0.399	47%	0.467	S	S	.	.	H	α-helix	trans	-60.8	-22.4	174.1	-56.7	0	0	0	0	113.2	A73	C69-A73 VanDerWaalsContact O-CB 3.27Å; C69-A73 WeakPolarHBondContact O-CB 3.23Å; C69-A73 PolarHBondContact O-N 3.08Å
70	A	82.6	Confident	80.1	Confident	43 Å²	43	85.2 Å²	85.2	36%	0.355	48%	0.476	S	S	.	.	H	α-helix	trans	-70.2	-46.8	177.1	0	0	0	0	0	110.9	S68 K72 A73 V74	S68-A70 PolarHBondContact O-N 3.42Å; S68-A70 VanDerWaalsContact O-N 3.14Å; A70-K72 VanDerWaalsContact C-N 3.34Å; A70-K72 PolarHBondContact O-N 3.39Å; A70-A73 PolarHBondContact O-N 3.13Å; A70-V74 WeakPolarHBondContact O-CG2 3.37Å; A70-V74 PolarHBondContact O-N 3.37Å
71	F	81.8	Confident	78.1	Confident	91 Å²	91	86 Å²	86	40%	0.399	49%	0.493	S	S	.	.	H	α-helix	trans	-61	-43.5	175.2	-175.8	-104	0	0	0	111.6	A65 M66 S68 A73 V74 L75	A65-F71 VanDerWaalsContact O-CB 3.25Å; A65-F71 WeakPolarHBondContact O-CB 3.16Å; M66-F71 HydrophobicContact CB-CD1 4.49Å; M66-F71 HydrophobicContact CB-CE1 4.48Å; M66-F71 HydrophobicContact CG-CE1 4.32Å; M66-F71 WeakPolarHBondContact O-CD1 3.45Å; S68-F71 PolarHBondContact O-N 3.09Å; S68-F71 PolarHBondContact OG-N 3.11Å; F71-A73 PolarHBondContact O-N 3.24Å; F71-V74 PolarHBondContact O-N 3.47Å; F71-L75 HydrophobicContact CD1-CD1 4Å; F71-L75 HydrophobicContact CE1-CD1 3.63Å; F71-L75 HydrophobicContact CE1-CG 4.38Å; F71-L75 HydrophobicContact CZ-CD1 4.2Å; F71-L75 WeakPolarHBondContact O-CG 3.44Å; F71-L75 PolarHBondContact O-N 2.85Å; F71-L75 VanDerWaalsContact O-N 3.08Å
72	K	84.6	Confident	76.7	Confident	117 Å²	117	83.9 Å²	83.9	51%	0.509	50%	0.498	S	S	.	.	H	α-helix	trans	-62.8	-38.8	175	-65.5	177.7	-178.6	174.5	0	113	S68 A70 L75 A76	S68-K72 PolarHBondContact O-N 3.31Å; A70-K72 VanDerWaalsContact C-N 3.34Å; A70-K72 PolarHBondContact O-N 3.39Å; K72-L75 PolarHBondContact O-N 3.01Å; K72-A76 PolarHBondContact O-N 3.23Å
73	A	81	Confident	74.5	Confident	26 Å²	26	88.5 Å²	88.5	22%	0.215	51%	0.514	C	S	.	.	H	α-helix	trans	-66.5	-41.8	177.1	0	0	0	0	0	112	C69 A70 F71 L75 A76 C77 W93	C69-A73 VanDerWaalsContact O-CB 3.27Å; C69-A73 WeakPolarHBondContact O-CB 3.23Å; C69-A73 PolarHBondContact O-N 3.08Å; A70-A73 PolarHBondContact O-N 3.13Å; F71-A73 PolarHBondContact O-N 3.24Å; A73-L75 VanDerWaalsContact C-N 3.33Å; A73-L75 PolarHBondContact O-N 3.44Å; A73-A76 WeakPolarHBondContact O-CB 3.4Å; A73-A76 PolarHBondContact O-N 3.29Å; A73-C77 PolarHBondContact O-N 3.31Å; A73-C77 PolarHBondContact O-SG 3.02Å; A73-W93 HydrophobicContact CB-CE3 4.36Å; A73-W93 HydrophobicContact CB-CZ3 4Å
74	V	83.8	Confident	72.8	Confident	91 Å²	91	93.3 Å²	93.3	55%	0.552	55%	0.548	S	S	*	.	H	α-helix	trans	-60.9	-43.9	175	173.5	0	0	0	0	110.9	A70 F71 A76 C77 V78	A70-V74 WeakPolarHBondContact O-CG2 3.37Å; A70-V74 PolarHBondContact O-N 3.37Å; F71-V74 PolarHBondContact O-N 3.47Å; V74-A76 VanDerWaalsContact C-N 3.31Å; V74-A76 PolarHBondContact O-N 3.45Å; V74-C77 PolarHBondContact O-N 3.23Å; V74-C77 VanDerWaalsContact O-N 3.11Å; V74-V78 HydrophobicContact CG1-CG2 4.27Å; V74-V78 WeakPolarHBondContact O-CG2 3.26Å; V74-V78 PolarHBondContact O-N 3.45Å
75	L	79.1	Confident	71.1	Confident	99 Å²	99	88.5 Å²	88.5	52%	0.518	55%	0.547	S	S	.	.	H	α-helix	trans	-59.8	-40.3	175.1	-71.7	175	0	0	0	112.4	F71 K72 A73 C77 V78 G79	F71-L75 HydrophobicContact CD1-CD1 4Å; F71-L75 HydrophobicContact CE1-CD1 3.63Å; F71-L75 HydrophobicContact CE1-CG 4.38Å; F71-L75 HydrophobicContact CZ-CD1 4.2Å; F71-L75 WeakPolarHBondContact O-CG 3.44Å; F71-L75 PolarHBondContact O-N 2.85Å; F71-L75 VanDerWaalsContact O-N 3.08Å; K72-L75 PolarHBondContact O-N 3.01Å; A73-L75 VanDerWaalsContact C-N 3.33Å; A73-L75 PolarHBondContact O-N 3.44Å; L75-C77 VanDerWaalsContact C-N 3.32Å; L75-C77 PolarHBondContact O-N 2.8Å; L75-V78 PolarHBondContact O-N 2.83Å; L75-G79 PolarHBondContact O-N 3.35Å
76	A	76.3	Confident	69.4	Low	53 Å²	53	91.9 Å²	91.9	44%	0.438	56%	0.558	S	S	.	*	H	α-helix	trans	-65.3	-33.9	175.1	0	0	0	0	0	112.7	K72 A73 V74	K72-A76 PolarHBondContact O-N 3.23Å; A73-A76 WeakPolarHBondContact O-CB 3.4Å; A73-A76 PolarHBondContact O-N 3.29Å; V74-A76 VanDerWaalsContact C-N 3.31Å; V74-A76 PolarHBondContact O-N 3.45Å
77	C	71.6	Confident	67.8	Low	77 Å²	77	93.4 Å²	93.4	52%	0.52	56%	0.564	S	S	.	*	H	α-helix	trans	-74.7	-35.2	177.2	-65.6	0	0	0	0	113.4	A73 V74 L75	A73-C77 PolarHBondContact O-N 3.31Å; A73-C77 PolarHBondContact O-SG 3.02Å; V74-C77 PolarHBondContact O-N 3.23Å; V74-C77 VanDerWaalsContact O-N 3.11Å; L75-C77 VanDerWaalsContact C-N 3.32Å; L75-C77 PolarHBondContact O-N 2.8Å
78	V	72.2	Confident	66.3	Low	117 Å²	117	94.7 Å²	94.7	71%	0.709	57%	0.57	S	S	*	*	H	α-helix	trans	-82.2	-23.9	-179.3	-179.4	0	0	0	0	111.9	V74 L75 V80	V74-V78 HydrophobicContact CG1-CG2 4.27Å; V74-V78 WeakPolarHBondContact O-CG2 3.26Å; V74-V78 PolarHBondContact O-N 3.45Å; L75-V78 PolarHBondContact O-N 2.83Å; V78-V80 VanDerWaalsContact C-N 3.29Å; V78-V80 PolarHBondContact O-N 3.02Å
79	G	63.5	Low	64.8	Low	59 Å²	59	98.3 Å²	98.3	61%	0.608	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76	-5.6	177.3	0	0	0	0	0	115.8	L75 P81	L75-G79 PolarHBondContact O-N 3.35Å; G79-P81 VanDerWaalsContact O-CD 3.31Å; G79-P81 WeakPolarHBondContact O-CD 3.28Å
80	V	52.9	Low	63.7	Low	100 Å²	100	101.5 Å²	101.5	61%	0.606	59%	0.587	S	S	*	*	S	Bend	trans	-106.8	97.5	177.3	-177.2	0	0	0	0	108.9	V78 G82	V78-V80 VanDerWaalsContact C-N 3.29Å; V78-V80 PolarHBondContact O-N 3.02Å; V80-G82 PolarHBondContact O-N 3.46Å
81	P	44.8	Very low	62.5	Low	127 Å²	127	105.1 Å²	105.1	83%	0.825	60%	0.596	S	S	*	*			trans	-71.1	98.7	175	29.8	-31.3	0	0	0	108.3	G79	G79-P81 VanDerWaalsContact O-CD 3.31Å; G79-P81 WeakPolarHBondContact O-CD 3.28Å
82	G	53.1	Low	61.4	Low	62 Å²	62	107.8 Å²	107.8	64%	0.639	61%	0.61	S	S	*	*			trans	70.4	105.7	166.2	0	0	0	0	0	115.3	V80	V80-G82 PolarHBondContact O-N 3.46Å
83	K	42	Very low	60.2	Low	197 Å²	197	107.7 Å²	107.7	86%	0.857	61%	0.606	S	S	*	*				-173.1	132.2	114.5	-100.5	-153.8	179	-174	0	111.2	G85	K83-G85 PolarHBondContact O-N 3.24Å; K83-G85 VanDerWaalsContact O-N 3.15Å
84	V	51.7	Low	59.2	Low	160 Å²	160	111.6 Å²	111.6	97%	0.97	62%	0.623	S	S	*	*	S	Bend	trans	-25.9	107.3	155.4	-178.4	0	0	0	0	111.6
85	G	50.5	Low	58	Low	57 Å²	57	113.6 Å²	113.6	59%	0.588	63%	0.626	S	S	*	*			trans	166.3	25.6	178.6	0	0	0	0	0	113.9	K83	K83-G85 PolarHBondContact O-N 3.24Å; K83-G85 VanDerWaalsContact O-N 3.15Å
86	L	50.4	Low	57.2	Low	119 Å²	119	114.1 Å²	114.1	62%	0.623	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.6	2.3	-167.5	-153.7	83.3	0	0	0	114	R90	L86-R90 WeakPolarHBondContact O-CB 3.39Å
87	E	54.7	Low	56.4	Low	137 Å²	137	116.2 Å²	116.2	64%	0.64	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.9	-48.9	-175.1	-159	169.7	119	0	0	111.9	R90 H91	E87-R90 VanDerWaalsContact O-CB 3.28Å; E87-R90 WeakPolarHBondContact O-CB 3.42Å; E87-R90 PolarHBondContact O-N 2.95Å; E87-H91 PolarHBondContact O-CD2 3.14Å
88	E	51.8	Low	55.9	Low	166 Å²	166	120.7 Å²	120.7	78%	0.776	63%	0.628	S	S	*	*	H	α-helix	trans	-65.8	-43.4	-178.7	-150.8	86.7	165.8	0	0	112.6	R90 H91	E88-R90 VanDerWaalsContact C-N 3.25Å; E88-R90 PolarHBondContact O-N 3.08Å; E88-H91 PolarHBondContact O-N 3.47Å
89	Q	52.4	Low	55.4	Low	108 Å²	108	118.9 Å²	118.9	51%	0.505	62%	0.621	S	S	.	*	H	α-helix	trans	-66.8	-25.9	177.6	-85.3	-88.8	33.2	0	0	112.7	H91 Q92 W93	Q89-H91 VanDerWaalsContact C-N 3.31Å; Q89-H91 PolarHBondContact O-N 3.18Å; Q89-Q92 PolarHBondContact O-N 3.34Å; Q89-W93 WeakPolarHBondContact O-CB 3.42Å; Q89-W93 PolarHBondContact O-N 3.27Å
90	R	56.8	Low	55	Low	126 Å²	126	121.9 Å²	121.9	48%	0.475	62%	0.619	S	S	.	*	H	α-helix	trans	-63.3	-39.1	177.1	-125.8	176.3	65.1	-133.4	-3.7	111.1	L86 E87 E88 L94	L86-R90 WeakPolarHBondContact O-CB 3.39Å; E87-R90 VanDerWaalsContact O-CB 3.28Å; E87-R90 WeakPolarHBondContact O-CB 3.42Å; E87-R90 PolarHBondContact O-N 2.95Å; E88-R90 VanDerWaalsContact C-N 3.25Å; E88-R90 PolarHBondContact O-N 3.08Å; R90-L94 HydrophobicContact CG-CD1 4.31Å; R90-L94 VanDerWaalsContact O-CB 3.26Å; R90-L94 WeakPolarHBondContact O-CB 3.49Å; R90-L94 VanDerWaalsContact O-CD1 3.23Å; R90-L94 WeakPolarHBondContact O-CD1 3.38Å; R90-L94 PolarHBondContact O-N 3.1Å
91	H	56.9	Low	55	Low	119 Å²	119	121.4 Å²	121.4	55%	0.551	61%	0.606	S	S	*	*	H	α-helix	trans	-69.4	-40.5	-178.5	-78.2	-93.4	0	0	0	111.9	E87 E88 Q89 L94 H95	E87-H91 PolarHBondContact O-CD2 3.14Å; E88-H91 PolarHBondContact O-N 3.47Å; Q89-H91 VanDerWaalsContact C-N 3.31Å; Q89-H91 PolarHBondContact O-N 3.18Å; H91-L94 PolarHBondContact O-N 3.22Å; H91-H95 WeakPolarHBondContact O-CB 3.49Å; H91-H95 PolarHBondContact O-N 2.98Å
92	Q	59.5	Low	55.1	Low	147 Å²	147	121 Å²	121	69%	0.687	60%	0.596	S	S	*	*	H	α-helix	trans	-70	-40.6	177.6	-163.3	160.7	89.2	0	0	111.9	Q89 H95 H96	Q89-Q92 PolarHBondContact O-N 3.34Å; Q92-H95 PolarHBondContact O-N 3.3Å; Q92-H96 WeakPolarHBondContact O-CB 3.27Å; Q92-H96 PolarHBondContact O-N 3.3Å
93	W	59.6	Low	54.8	Low	114 Å²	114	122.1 Å²	122.1	43%	0.432	59%	0.592	S	S	.	*	H	α-helix	trans	-65.5	-41.7	171.5	-94.2	83.3	0	0	0	112.9	A73 Q89 H95 H96 W97	A73-W93 HydrophobicContact CB-CE3 4.36Å; A73-W93 HydrophobicContact CB-CZ3 4Å; Q89-W93 WeakPolarHBondContact O-CB 3.42Å; Q89-W93 PolarHBondContact O-N 3.27Å; W93-H95 VanDerWaalsContact C-N 3.34Å; W93-H95 PolarHBondContact O-N 2.85Å; W93-H96 PolarHBondContact O-N 3.34Å; W93-W97 WeakPolarHBondContact O-CB 3.37Å; W93-W97 PolarHBondContact O-N 2.97Å
94	L	58.8	Low	54.9	Low	108 Å²	108	117 Å²	117	57%	0.565	58%	0.581	S	S	*	*	H	α-helix	trans	-61.4	-43.6	176	-109.2	90.9	0	0	0	111.2	R90 H91 W97 R98	R90-L94 HydrophobicContact CG-CD1 4.31Å; R90-L94 VanDerWaalsContact O-CB 3.26Å; R90-L94 WeakPolarHBondContact O-CB 3.49Å; R90-L94 VanDerWaalsContact O-CD1 3.23Å; R90-L94 WeakPolarHBondContact O-CD1 3.38Å; R90-L94 PolarHBondContact O-N 3.1Å; H91-L94 PolarHBondContact O-N 3.22Å; L94-W97 PolarHBondContact O-N 3.49Å; L94-R98 WeakPolarHBondContact O-CB 3.38Å; L94-R98 PolarHBondContact O-N 3.45Å
95	H	60	Low	54.4	Low	134 Å²	134	117 Å²	117	62%	0.62	56%	0.564	S	S	*	*	H	α-helix	trans	-65.9	-45.1	179.5	-120	-86.2	0	0	0	111.5	H91 Q92 W93 R98 S99	H91-H95 WeakPolarHBondContact O-CB 3.49Å; H91-H95 PolarHBondContact O-N 2.98Å; Q92-H95 PolarHBondContact O-N 3.3Å; W93-H95 VanDerWaalsContact C-N 3.34Å; W93-H95 PolarHBondContact O-N 2.85Å; H95-R98 PolarHBondContact O-N 2.75Å; H95-S99 WeakPolarHBondContact O-CB 3.25Å; H95-S99 PolarHBondContact O-N 3.08Å; H95-S99 PolarHBondContact O-OG 2.79Å; H95-S99 VanDerWaalsContact O-OG 3.12Å
96	H	61.8	Low	53.9	Low	110 Å²	110	118.8 Å²	118.8	51%	0.509	57%	0.568	S	S	.	*	H	α-helix	trans	-62.7	-44.2	175.9	-173.7	77.1	0	0	0	111.8	Q92 W93 R98 S99 H100	Q92-H96 WeakPolarHBondContact O-CB 3.27Å; Q92-H96 PolarHBondContact O-N 3.3Å; W93-H96 PolarHBondContact O-N 3.34Å; H96-R98 PolarHBondContact O-N 3.26Å; H96-S99 PolarHBondContact O-N 3.46Å; H96-H100 AromaticContact CE1-CD2 3.29Å; H96-H100 PolarHBondContact CE1-CD2 3.19Å; H96-H100 AromaticContact CE1-NE2 3.23Å; H96-H100 PolarHBondContact CE1-NE2 3.05Å; H96-H100 AromaticContact ND1-CD2 3.55Å; H96-H100 AromaticContact ND1-NE2 3.67Å; H96-H100 AromaticContact NE2-CD2 3.64Å; H96-H100 AromaticContact NE2-NE2 3.94Å; H96-H100 PolarHBondContact O-CD2 3.39Å; H96-H100 VanDerWaalsContact O-CD2 3.31Å; H96-H100 PolarHBondContact O-N 2.98Å
97	W	58.4	Low	53.7	Low	96 Å²	96	122.5 Å²	122.5	36%	0.364	58%	0.579	S	S	.	*	H	α-helix	trans	-63	-40.7	176.5	-165.5	88.5	0	0	0	112.2	W93 L94 R101	W93-W97 WeakPolarHBondContact O-CB 3.37Å; W93-W97 PolarHBondContact O-N 2.97Å; L94-W97 PolarHBondContact O-N 3.49Å; W97-R101 VanDerWaalsContact CE2-NE 3.3Å; W97-R101 VanDerWaalsContact CH2-CD 3.49Å; W97-R101 VanDerWaalsContact CZ2-CD 3.42Å; W97-R101 VanDerWaalsContact CZ2-NH1 3.3Å; W97-R101 WeakPolarHBondContact O-CB 3.34Å; W97-R101 PolarHBondContact O-N 3.46Å
98	R	61.1	Low	53.2	Low	172 Å²	172	119.2 Å²	119.2	65%	0.649	58%	0.582	S	S	*	*	H	α-helix	trans	-64.2	-44.5	176	-165	175.7	-136.3	-141.1	2.8	111.1	L94 H95 H96 H100 L102	L94-R98 WeakPolarHBondContact O-CB 3.38Å; L94-R98 PolarHBondContact O-N 3.45Å; H95-R98 PolarHBondContact O-N 2.75Å; H96-R98 PolarHBondContact O-N 3.26Å; R98-H100 PolarHBondContact O-N 3.11Å; R98-L102 HydrophobicContact CG-CD1 3.64Å; R98-L102 WeakPolarHBondContact O-CD1 3.31Å; R98-L102 PolarHBondContact O-N 2.94Å
99	S	61.9	Low	53	Low	78 Å²	78	117.5 Å²	117.5	55%	0.545	57%	0.568	S	S	.	*	H	α-helix	trans	-66.3	-36.8	179.6	-65.6	0	0	0	0	113.5	H95 H96 P103	H95-S99 WeakPolarHBondContact O-CB 3.25Å; H95-S99 PolarHBondContact O-N 3.08Å; H95-S99 PolarHBondContact O-OG 2.79Å; H95-S99 VanDerWaalsContact O-OG 3.12Å; H96-S99 PolarHBondContact O-N 3.46Å; S99-P103 WeakPolarHBondContact O-CD 3.49Å
100	H	56	Low	52.4	Low	122 Å²	122	114.9 Å²	114.9	57%	0.565	57%	0.57	S	S	*	*	H	α-helix	trans	-92	-19.8	-176.9	-75.2	-88	0	0	0	114.8	H96 R98	H96-H100 AromaticContact CE1-CD2 3.29Å; H96-H100 PolarHBondContact CE1-CD2 3.19Å; H96-H100 AromaticContact CE1-NE2 3.23Å; H96-H100 PolarHBondContact CE1-NE2 3.05Å; H96-H100 AromaticContact ND1-CD2 3.55Å; H96-H100 AromaticContact ND1-NE2 3.67Å; H96-H100 AromaticContact NE2-CD2 3.64Å; H96-H100 AromaticContact NE2-NE2 3.94Å; H96-H100 PolarHBondContact O-CD2 3.39Å; H96-H100 VanDerWaalsContact O-CD2 3.31Å; H96-H100 PolarHBondContact O-N 2.98Å; R98-H100 PolarHBondContact O-N 3.11Å
101	R	53.5	Low	51.7	Low	90 Å²	90	117.9 Å²	117.9	34%	0.34	59%	0.589	S	S	.	*	H	α-helix	trans	-92.7	-30.1	-176.6	-169.2	178.2	-107.3	-131.8	2.1	114.5	W97 S104 W105	W97-R101 VanDerWaalsContact CE2-NE 3.3Å; W97-R101 VanDerWaalsContact CH2-CD 3.49Å; W97-R101 VanDerWaalsContact CZ2-CD 3.42Å; W97-R101 VanDerWaalsContact CZ2-NH1 3.3Å; W97-R101 WeakPolarHBondContact O-CB 3.34Å; W97-R101 PolarHBondContact O-N 3.46Å; R101-S104 PolarHBondContact O-N 3.42Å; R101-W105 PolarHBondContact O-N 3.15Å; R101-W105 VanDerWaalsContact O-N 3.12Å
102	L	46.7	Very low	51.2	Low	118 Å²	118	123.4 Å²	123.4	62%	0.618	61%	0.605	S	S	*	*	H	α-helix	trans	-62.5	-41.1	-180	-95.5	137.4	0	0	0	114	R98	R98-L102 HydrophobicContact CG-CD1 3.64Å; R98-L102 WeakPolarHBondContact O-CD1 3.31Å; R98-L102 PolarHBondContact O-N 2.94Å
103	P	47	Very low	50.4	Low	86 Å²	86	122.9 Å²	122.9	56%	0.558	61%	0.606	S	S	*	*	H	α-helix	trans	-71.7	-34.2	177.6	-17.4	31	0	0	0	113	S99	S99-P103 WeakPolarHBondContact O-CD 3.49Å
104	S	44.1	Very low	49.1	Very low	90 Å²	90	130.2 Å²	130.2	63%	0.629	63%	0.634	S	S	*	*	H	α-helix	trans	-71.9	-38.1	-177.5	176.5	0	0	0	0	112.4	R101 K107	R101-S104 PolarHBondContact O-N 3.42Å; S104-K107 PolarHBondContact O-N 3.4Å
105	W	41.1	Very low	47.9	Very low	161 Å²	161	136.4 Å²	136.4	61%	0.61	65%	0.65	S	S	*	*	H	α-helix	trans	-74	-27.5	179.5	-152.2	27.3	0	0	0	113.4	R101 R109	R101-W105 PolarHBondContact O-N 3.15Å; R101-W105 VanDerWaalsContact O-N 3.12Å; W105-R109 VanDerWaalsContact CE2-NH1 3.28Å; W105-R109 VanDerWaalsContact CE3-NH2 3.28Å
106	S	40.1	Very low	46.8	Very low	94 Å²	94	140.5 Å²	140.5	66%	0.657	68%	0.684	S	S	*	*	H	α-helix	trans	-72.2	-27.7	177	-165	0	0	0	0	112.7
107	K	45.9	Very low	46.1	Very low	197 Å²	197	142 Å²	142	86%	0.857	69%	0.692	S	S	*	*	H	α-helix	trans	-83.9	-12.4	-176	-144.9	148.5	-174.4	171.2	0	113.8	S104	S104-K107 PolarHBondContact O-N 3.4Å
108	G	44.7	Very low	45.4	Very low	68 Å²	68	144.4 Å²	144.4	70%	0.701	71%	0.71	S	S	*	*	S	Bend	trans	-105.5	-2.4	-179.6	0	0	0	0	0	116.5
109	R	47.2	Very low	44.5	Very low	129 Å²	129	142.9 Å²	142.9	49%	0.487	71%	0.713	S	S	.	*			trans	-129.3	39.8	-177.8	-71.7	-163.8	-62	-160.5	7	113.8	W105 H111	W105-R109 VanDerWaalsContact CE2-NH1 3.28Å; W105-R109 VanDerWaalsContact CE3-NH2 3.28Å; R109-H111 VanDerWaalsContact C-N 3.35Å; R109-H111 PolarHBondContact O-N 3.04Å
110	G	39.8	Very low	43.5	Very low	54 Å²	54	146.7 Å²	146.7	56%	0.557	72%	0.723	S	S	*	*	S	Bend	trans	-73.7	-1.2	-174	0	0	0	0	0	118
111	H	42	Very low	42.7	Very low	188 Å²	188	148.3 Å²	148.3	87%	0.87	73%	0.733	S	S	*	*	S	Bend	trans	-146.6	10.8	-172.4	-69	-73.8	0	0	0	118.7	R109	R109-H111 VanDerWaalsContact C-N 3.35Å; R109-H111 PolarHBondContact O-N 3.04Å
112	R	45.9	Very low	42	Very low	236 Å²	236	152.1 Å²	152.1	89%	0.891	76%	0.759	S	S	*	*	S	Bend	trans	-144.1	20.5	-174.5	-89.5	-157	-78.7	-99	5.8	118.4
113	L	42.1	Very low	41.7	Very low	136 Å²	136	154.6 Å²	154.6	71%	0.712	77%	0.769	S	S	*	*			trans	-148.9	49.8	-179	-142.6	77.7	0	0	0	114.7
114	W	32.7	Very low	41.3	Very low	267 Å²	267	159.8 Å²	159.8	100%	1.011	79%	0.785	S	S	*	*			trans	-138.2	62.8	161.5	-73.3	97.8	0	0	0	109.3
115	R	34.6	Very low	41	Very low	239 Å²	239	165.7 Å²	165.7	90%	0.902	80%	0.798	S	S	*	*			trans	-160.3	79.8	160.9	-165	-171.4	-68.1	-159.7	0.4	109.2
116	V	36.2	Very low	41	Very low	219 Å²	219	166.1 Å²	166.1	100%	1.327	82%	0.816	S	S	*	*			trans	-159.8	0	134.7	171.3	0	0	0	0	105.3

Retrieved 116 of 116 residues in 134.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).