SYBL_SCHMA Loading...

Isoform Short of Synaptobrevin-like protein AlphaSync

Canonical isoform description: Unknown, but synaptobrevins are presumed to be involved in targeting and fusion of synaptic vesicles with the presynaptic membrane as well as in neurotransmitter release.

AlphaFold DB , UniProt , Accession Q27236-2 (canonical: Q27236), Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 102 aa.

						>SYBL_SCHMA|Q27236-2
MLHITTMTDKAPIKTNKRLQQTQAQVNEVVDIMRVNVDKVLERDKNLSELDGRADALQAGASQFEASAGKLKRKFWWKNCKYGSFLNKKIKLNKVNIHLIIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.6	Low	51.9	Low	224 Å²	224	149.5 Å²	149.5	100%	1.103	79%	0.794	S	S	*	*				0	109.2	0	-94.7	-157.2	178.8	0	0	108.5	H3	M1-H3 PolarHBondContact O-N 3.47Å
2	L	44.6	Very low	52.6	Low	173 Å²	173	143 Å²	143	91%	0.906	77%	0.767	S	S	*	*			trans	-77.3	115.5	168.8	-84.6	153.2	0	0	0	107.8	I4	L2-I4 PolarHBondContact O-N 3.13Å; L2-I4 VanDerWaalsContact O-N 3.13Å
3	H	47.6	Very low	53.5	Low	164 Å²	164	141.5 Å²	141.5	76%	0.759	76%	0.756	S	S	*	*			trans	-71.9	99.6	171.1	-75.9	105.7	0	0	0	108.6	M1 T5	M1-H3 PolarHBondContact O-N 3.47Å; H3-T5 PolarHBondContact O-N 3.05Å; H3-T5 VanDerWaalsContact O-N 3.11Å
4	I	51.2	Low	54.9	Low	147 Å²	147	144.3 Å²	144.3	75%	0.754	76%	0.759	S	S	*	*			trans	-80.8	80.9	164.5	-44.1	174.9	0	0	0	106.2	L2 T6	L2-I4 PolarHBondContact O-N 3.13Å; L2-I4 VanDerWaalsContact O-N 3.13Å; I4-T6 VanDerWaalsContact C-N 3.31Å; I4-T6 HydrophobicContact CG2-CG2 4.15Å; I4-T6 PolarHBondContact O-N 3.11Å
5	T	55	Low	56.6	Low	121 Å²	121	140.4 Å²	140.4	74%	0.742	74%	0.743	S	S	*	*			trans	-74.1	95.2	165.9	-58.1	0	0	0	0	106.7	H3 M7	H3-T5 PolarHBondContact O-N 3.05Å; H3-T5 VanDerWaalsContact O-N 3.11Å; T5-M7 PolarHBondContact O-N 3.26Å
6	T	46.2	Very low	58.2	Low	111 Å²	111	136.7 Å²	136.7	68%	0.681	72%	0.724	S	S	*	*			trans	-61.4	126.3	174.4	50	0	0	0	0	110.1	I4 T8	I4-T6 VanDerWaalsContact C-N 3.31Å; I4-T6 HydrophobicContact CG2-CG2 4.15Å; I4-T6 PolarHBondContact O-N 3.11Å; T6-T8 PolarHBondContact O-N 3.38Å
7	M	50.9	Low	59.9	Low	174 Å²	174	136.7 Å²	136.7	86%	0.857	72%	0.716	S	S	*	*			trans	-33.5	111.6	175.4	-53.4	-62.6	-175.8	0	0	114	T5 D9	T5-M7 PolarHBondContact O-N 3.26Å; M7-D9 PolarHBondContact O-N 3.27Å
8	T	52.2	Low	61.5	Low	121 Å²	121	139.6 Å²	139.6	74%	0.742	72%	0.716	S	S	*	*			trans	-85.2	82.5	160.8	60.7	0	0	0	0	108.3	T6 K10	T6-T8 PolarHBondContact O-N 3.38Å; T8-K10 PolarHBondContact O-N 2.89Å
9	D	52.9	Low	63	Low	141 Å²	141	138.2 Å²	138.2	75%	0.754	71%	0.71	S	S	*	*			trans	-64.1	101.9	168.8	-101.4	-36.2	0	0	0	109.1	M7 A11 P12	M7-D9 PolarHBondContact O-N 3.27Å; D9-A11 PolarHBondContact O-N 2.97Å; D9-P12 VanDerWaalsContact O-CD 3.28Å; D9-P12 WeakPolarHBondContact O-CD 3.28Å
10	K	53.4	Low	64.4	Low	199 Å²	199	137.5 Å²	137.5	87%	0.865	70%	0.703	S	S	*	*			trans	-73.2	40.6	-177.9	-86	-159.1	177.7	-176.8	0	113.9	T8	T8-K10 PolarHBondContact O-N 2.89Å
11	A	60	Low	65.6	Low	69 Å²	69	137.1 Å²	137.1	57%	0.57	70%	0.698	S	S	*	*			trans	-110	8.1	175.5	0	0	0	0	0	118.8	D9 T15	D9-A11 PolarHBondContact O-N 2.97Å; A11-T15 PolarHBondContact O-OG1 3.27Å; A11-T15 VanDerWaalsContact O-OG1 3.12Å
12	P	60.4	Low	67.3	Low	72 Å²	72	130 Å²	130	47%	0.468	67%	0.667	S	S	.	*	H	α-helix	trans	-87.2	-21.2	179.5	30.2	-32.9	0	0	0	115.5	D9 T15 N16	D9-P12 VanDerWaalsContact O-CD 3.28Å; D9-P12 WeakPolarHBondContact O-CD 3.28Å; P12-T15 PolarHBondContact O-OG1 3.29Å; P12-T15 VanDerWaalsContact O-OG1 3.06Å; P12-N16 WeakPolarHBondContact O-CB 3.28Å; P12-N16 PolarHBondContact O-N 2.86Å; P12-N16 PolarHBondContact O-ND2 2.94Å
13	I	64.1	Low	69.6	Low	123 Å²	123	126.4 Å²	126.4	63%	0.631	65%	0.646	S	S	*	*	H	α-helix	trans	-81.9	-42.7	-170.4	-56.1	-106.8	0	0	0	112	K17	I13-K17 PolarHBondContact O-N 3.39Å
14	K	73.8	Confident	71.8	Confident	181 Å²	181	121.4 Å²	121.4	79%	0.787	63%	0.633	S	S	*	*	H	α-helix	trans	-68.7	-38.5	-179.1	-73.3	-171.9	-179.7	-176.6	0	112.2	K17 R18	K14-K17 PolarHBondContact O-N 3.36Å; K14-R18 PolarHBondContact O-N 2.89Å
15	T	79.5	Confident	73.9	Confident	86 Å²	86	120.1 Å²	120.1	53%	0.528	62%	0.624	S	S	.	*	H	α-helix	trans	-64.6	-43.9	176.7	46.3	0	0	0	0	111.3	A11 P12 K17 R18 L19	A11-T15 PolarHBondContact O-OG1 3.27Å; A11-T15 VanDerWaalsContact O-OG1 3.12Å; P12-T15 PolarHBondContact O-OG1 3.29Å; P12-T15 VanDerWaalsContact O-OG1 3.06Å; T15-K17 PolarHBondContact O-N 3.4Å; T15-R18 PolarHBondContact O-N 3.47Å; T15-L19 WeakPolarHBondContact O-CB 3.49Å; T15-L19 PolarHBondContact O-N 3.06Å
16	N	82.5	Confident	75.8	Confident	81 Å²	81	117.8 Å²	117.8	43%	0.433	61%	0.609	S	S	.	*	H	α-helix	trans	-58	-44.4	175.1	-96.7	-73.3	0	0	0	113.2	P12 R18 L19 Q20	P12-N16 WeakPolarHBondContact O-CB 3.28Å; P12-N16 PolarHBondContact O-N 2.86Å; P12-N16 PolarHBondContact O-ND2 2.94Å; N16-R18 PolarHBondContact O-N 3.49Å; N16-L19 PolarHBondContact O-N 3.01Å; N16-Q20 WeakPolarHBondContact O-CB 3.48Å; N16-Q20 VanDerWaalsContact O-CG 3.28Å; N16-Q20 WeakPolarHBondContact O-CG 3.38Å; N16-Q20 PolarHBondContact O-N 3.32Å
17	K	87.5	Confident	78.2	Confident	137 Å²	137	116.2 Å²	116.2	60%	0.596	60%	0.597	S	S	*	*	H	α-helix	trans	-62.2	-43.9	178.4	-72.2	-172.2	179.9	-173.7	0	112.6	I13 K14 T15 Q20 Q21	I13-K17 PolarHBondContact O-N 3.39Å; K14-K17 PolarHBondContact O-N 3.36Å; T15-K17 PolarHBondContact O-N 3.4Å; K17-Q20 PolarHBondContact O-N 3.31Å; K17-Q21 WeakPolarHBondContact O-CG 3.45Å; K17-Q21 PolarHBondContact O-N 2.98Å
18	R	88.2	Confident	80.4	Confident	189 Å²	189	113.8 Å²	113.8	71%	0.713	58%	0.583	S	S	*	*	H	α-helix	trans	-62.8	-44.1	176.1	-74.1	-173.4	174.9	178.4	-2.1	111.3	K14 T15 N16 Q20 Q21 T22	K14-R18 PolarHBondContact O-N 2.89Å; T15-R18 PolarHBondContact O-N 3.47Å; N16-R18 PolarHBondContact O-N 3.49Å; R18-Q20 PolarHBondContact O-N 3.32Å; R18-Q21 PolarHBondContact O-N 3.12Å; R18-T22 PolarHBondContact O-N 3.49Å; R18-T22 PolarHBondContact O-OG1 2.91Å; R18-T22 VanDerWaalsContact O-OG1 3.12Å
19	L	89.5	Confident	82.5	Confident	113 Å²	113	112 Å²	112	59%	0.592	57%	0.572	S	S	*	*	H	α-helix	trans	-61.4	-43.1	176.9	-178.8	61.6	0	0	0	112	T15 N16 T22 Q23	T15-L19 WeakPolarHBondContact O-CB 3.49Å; T15-L19 PolarHBondContact O-N 3.06Å; N16-L19 PolarHBondContact O-N 3.01Å; L19-T22 PolarHBondContact O-N 3.31Å; L19-Q23 WeakPolarHBondContact O-CB 3.34Å; L19-Q23 PolarHBondContact O-N 3.44Å
20	Q	90.8	Very high	84.6	Confident	124 Å²	124	108.1 Å²	108.1	58%	0.579	55%	0.553	S	S	*	*	H	α-helix	trans	-62.6	-41.3	175.9	-73.2	172	25.8	0	0	112.2	N16 K17 R18 Q23 A24	N16-Q20 WeakPolarHBondContact O-CB 3.48Å; N16-Q20 VanDerWaalsContact O-CG 3.28Å; N16-Q20 WeakPolarHBondContact O-CG 3.38Å; N16-Q20 PolarHBondContact O-N 3.32Å; K17-Q20 PolarHBondContact O-N 3.31Å; R18-Q20 PolarHBondContact O-N 3.32Å; Q20-Q23 PolarHBondContact O-N 3.43Å; Q20-A24 WeakPolarHBondContact O-CB 3.33Å; Q20-A24 PolarHBondContact O-N 3.49Å
21	Q	91.5	Very high	86.7	Confident	130 Å²	130	102.6 Å²	102.6	61%	0.607	53%	0.533	S	S	*	.	H	α-helix	trans	-62.2	-46.8	174	-74.4	175.1	-24.5	0	0	111.4	K17 R18 Q23 A24 Q25	K17-Q21 WeakPolarHBondContact O-CG 3.45Å; K17-Q21 PolarHBondContact O-N 2.98Å; R18-Q21 PolarHBondContact O-N 3.12Å; Q21-Q23 VanDerWaalsContact C-N 3.32Å; Q21-Q23 PolarHBondContact O-N 3.23Å; Q21-A24 PolarHBondContact O-N 3.46Å; Q21-Q25 WeakPolarHBondContact O-CG 3.43Å; Q21-Q25 PolarHBondContact O-N 2.89Å
22	T	92.3	Very high	88.5	Confident	73 Å²	73	103.3 Å²	103.3	45%	0.448	53%	0.527	S	S	.	.	H	α-helix	trans	-62.2	-39.7	176.4	-59.1	0	0	0	0	111.5	R18 L19 A24 Q25 V26	R18-T22 PolarHBondContact O-N 3.49Å; R18-T22 PolarHBondContact O-OG1 2.91Å; R18-T22 VanDerWaalsContact O-OG1 3.12Å; L19-T22 PolarHBondContact O-N 3.31Å; T22-A24 PolarHBondContact O-N 2.93Å; T22-Q25 PolarHBondContact O-N 3.24Å; T22-V26 HydrophobicContact CG2-CG2 4.38Å; T22-V26 WeakPolarHBondContact O-CB 3.42Å; T22-V26 VanDerWaalsContact O-CG2 3.26Å; T22-V26 WeakPolarHBondContact O-CG2 3.49Å; T22-V26 PolarHBondContact O-N 3.4Å
23	Q	91.7	Very high	90.2	Very high	99 Å²	99	104.8 Å²	104.8	46%	0.463	53%	0.529	S	S	.	.	H	α-helix	trans	-63	-41.4	175.2	-172.7	62.7	60.6	0	0	111.9	L19 Q20 Q21 V26 N27	L19-Q23 WeakPolarHBondContact O-CB 3.34Å; L19-Q23 PolarHBondContact O-N 3.44Å; Q20-Q23 PolarHBondContact O-N 3.43Å; Q21-Q23 VanDerWaalsContact C-N 3.32Å; Q21-Q23 PolarHBondContact O-N 3.23Å; Q23-V26 PolarHBondContact O-N 2.96Å; Q23-N27 PolarHBondContact NE2-OD1 2.94Å; Q23-N27 WeakPolarHBondContact O-CB 3.48Å; Q23-N27 PolarHBondContact O-N 3.48Å; Q23-N27 PolarHBondContact O-ND2 2.99Å; Q23-N27 PolarHBondContact O-OD1 3.33Å
24	A	94.3	Very high	91.9	Very high	59 Å²	59	106.4 Å²	106.4	49%	0.488	53%	0.527	S	S	.	.	H	α-helix	trans	-63.3	-43.9	175.7	0	0	0	0	0	111.7	Q20 Q21 T22 N27 E28	Q20-A24 WeakPolarHBondContact O-CB 3.33Å; Q20-A24 PolarHBondContact O-N 3.49Å; Q21-A24 PolarHBondContact O-N 3.46Å; T22-A24 PolarHBondContact O-N 2.93Å; A24-N27 PolarHBondContact O-N 3.33Å; A24-E28 PolarHBondContact O-N 3.48Å
25	Q	95.2	Very high	93	Very high	120 Å²	120	101.1 Å²	101.1	56%	0.561	51%	0.509	S	S	*	.	H	α-helix	trans	-63	-42.4	175.6	-71.5	178.1	-43.3	0	0	112.2	Q21 T22 E28 V29	Q21-Q25 WeakPolarHBondContact O-CG 3.43Å; Q21-Q25 PolarHBondContact O-N 2.89Å; T22-Q25 PolarHBondContact O-N 3.24Å; Q25-E28 PolarHBondContact O-N 3.22Å; Q25-V29 WeakPolarHBondContact O-CG2 3.26Å; Q25-V29 PolarHBondContact O-N 3.48Å
26	V	95.7	Very high	93.9	Very high	71 Å²	71	100.1 Å²	100.1	43%	0.43	50%	0.501	S	S	.	.	H	α-helix	trans	-63.8	-43.7	176.4	170.5	0	0	0	0	110.4	T22 Q23 E28 V29 V30	T22-V26 HydrophobicContact CG2-CG2 4.38Å; T22-V26 WeakPolarHBondContact O-CB 3.42Å; T22-V26 VanDerWaalsContact O-CG2 3.26Å; T22-V26 WeakPolarHBondContact O-CG2 3.49Å; T22-V26 PolarHBondContact O-N 3.4Å; Q23-V26 PolarHBondContact O-N 2.96Å; V26-E28 PolarHBondContact O-N 3.44Å; V26-V29 PolarHBondContact O-N 3.12Å; V26-V30 HydrophobicContact CG1-CG2 4.27Å; V26-V30 WeakPolarHBondContact O-CB 3.5Å; V26-V30 VanDerWaalsContact O-CG2 3.22Å; V26-V30 WeakPolarHBondContact O-CG2 3.22Å; V26-V30 PolarHBondContact O-N 3.06Å
27	N	95.8	Very high	94.6	Very high	79 Å²	79	99.8 Å²	99.8	42%	0.422	50%	0.501	S	S	.	.	H	α-helix	trans	-60.7	-44.6	176.9	-68.7	-9.5	0	0	0	111.5	Q23 A24 V29 V30 D31	Q23-N27 PolarHBondContact NE2-OD1 2.94Å; Q23-N27 WeakPolarHBondContact O-CB 3.48Å; Q23-N27 PolarHBondContact O-N 3.48Å; Q23-N27 PolarHBondContact O-ND2 2.99Å; Q23-N27 PolarHBondContact O-OD1 3.33Å; A24-N27 PolarHBondContact O-N 3.33Å; N27-V29 PolarHBondContact O-N 2.92Å; N27-V30 WeakPolarHBondContact O-CB 3.43Å; N27-V30 PolarHBondContact O-N 3.42Å; N27-D31 VanDerWaalsContact O-CG 3.3Å; N27-D31 PolarHBondContact O-N 2.87Å
28	E	96.8	Very high	95.2	Very high	122 Å²	122	98.4 Å²	98.4	57%	0.57	50%	0.501	S	S	*	.	H	α-helix	trans	-59	-47	175.7	-179.5	-179.6	-159.6	0	0	111.9	A24 Q25 V26 V30 D31 I32	A24-E28 PolarHBondContact O-N 3.48Å; Q25-E28 PolarHBondContact O-N 3.22Å; V26-E28 PolarHBondContact O-N 3.44Å; E28-V30 VanDerWaalsContact C-N 3.33Å; E28-V30 PolarHBondContact O-N 2.82Å; E28-D31 PolarHBondContact O-N 3.31Å; E28-I32 HydrophobicContact CG-CD1 4.19Å; E28-I32 WeakPolarHBondContact O-CG1 3.37Å; E28-I32 PolarHBondContact O-N 2.92Å
29	V	96.3	Very high	95.6	Very high	83 Å²	83	95.6 Å²	95.6	50%	0.503	49%	0.494	S	S	.	.	H	α-helix	trans	-65	-38.5	177.5	173.9	0	0	0	0	111.4	Q25 V26 N27 D31 I32 M33	Q25-V29 WeakPolarHBondContact O-CG2 3.26Å; Q25-V29 PolarHBondContact O-N 3.48Å; V26-V29 PolarHBondContact O-N 3.12Å; N27-V29 PolarHBondContact O-N 2.92Å; V29-D31 VanDerWaalsContact C-N 3.32Å; V29-D31 PolarHBondContact O-N 3.34Å; V29-I32 PolarHBondContact O-N 3.5Å; V29-M33 HydrophobicContact CG1-CG 4.35Å; V29-M33 WeakPolarHBondContact O-CB 3.44Å; V29-M33 VanDerWaalsContact O-CG 3.31Å; V29-M33 WeakPolarHBondContact O-CG 3.42Å; V29-M33 PolarHBondContact O-N 2.9Å
30	V	97.2	Very high	96.1	Very high	61 Å²	61	94.2 Å²	94.2	37%	0.37	49%	0.49	S	S	.	.	H	α-helix	trans	-61.3	-43.2	174.4	167.5	0	0	0	0	110.5	V26 N27 E28 M33 R34	V26-V30 HydrophobicContact CG1-CG2 4.27Å; V26-V30 WeakPolarHBondContact O-CB 3.5Å; V26-V30 VanDerWaalsContact O-CG2 3.22Å; V26-V30 WeakPolarHBondContact O-CG2 3.22Å; V26-V30 PolarHBondContact O-N 3.06Å; N27-V30 WeakPolarHBondContact O-CB 3.43Å; N27-V30 PolarHBondContact O-N 3.42Å; E28-V30 VanDerWaalsContact C-N 3.33Å; E28-V30 PolarHBondContact O-N 2.82Å; V30-M33 PolarHBondContact O-N 3.11Å; V30-R34 WeakPolarHBondContact O-CG 3.31Å; V30-R34 PolarHBondContact O-N 3.01Å
31	D	97.2	Very high	96.4	Very high	83 Å²	83	93.4 Å²	93.4	44%	0.444	49%	0.489	S	S	.	.	H	α-helix	trans	-65.1	-42	177.5	-69.5	-28.1	0	0	0	111.5	N27 E28 V29 M33 R34 V35	N27-D31 VanDerWaalsContact O-CG 3.3Å; N27-D31 PolarHBondContact O-N 2.87Å; E28-D31 PolarHBondContact O-N 3.31Å; V29-D31 VanDerWaalsContact C-N 3.32Å; V29-D31 PolarHBondContact O-N 3.34Å; D31-M33 VanDerWaalsContact C-N 3.33Å; D31-M33 PolarHBondContact O-N 3.25Å; D31-R34 PolarHBondContact O-N 3.29Å; D31-R34 IonicContact OD1-CZ 3.91Å; D31-R34 IonicContact OD1-NH1 3.49Å; D31-R34 PolarHBondContact OD1-NH1 3.35Å; D31-V35 PolarHBondContact O-N 3.5Å
32	I	97.4	Very high	96.8	Very high	84 Å²	84	92 Å²	92	43%	0.431	48%	0.482	S	S	.	.	H	α-helix	trans	-59.8	-44.3	172.5	-68.4	166.1	0	0	0	110.8	E28 V29 R34 V35 N36	E28-I32 HydrophobicContact CG-CD1 4.19Å; E28-I32 WeakPolarHBondContact O-CG1 3.37Å; E28-I32 PolarHBondContact O-N 2.92Å; V29-I32 PolarHBondContact O-N 3.5Å; I32-R34 PolarHBondContact O-N 3.25Å; I32-V35 PolarHBondContact O-N 2.85Å; I32-N36 VanDerWaalsContact O-CG 3.29Å; I32-N36 PolarHBondContact O-N 3.33Å
33	M	97.8	Very high	97.1	Very high	103 Å²	103	96.3 Å²	96.3	51%	0.507	49%	0.49	S	S	.	.	H	α-helix	trans	-68.6	-32.8	-179.1	-74.8	-59	-64.2	0	0	112.5	V29 V30 D31 N36 V37	V29-M33 HydrophobicContact CG1-CG 4.35Å; V29-M33 WeakPolarHBondContact O-CB 3.44Å; V29-M33 VanDerWaalsContact O-CG 3.31Å; V29-M33 WeakPolarHBondContact O-CG 3.42Å; V29-M33 PolarHBondContact O-N 2.9Å; V30-M33 PolarHBondContact O-N 3.11Å; D31-M33 VanDerWaalsContact C-N 3.33Å; D31-M33 PolarHBondContact O-N 3.25Å; M33-N36 PolarHBondContact O-N 3.02Å; M33-N36 HydrophobicContact SD-CB 4.47Å; M33-V37 VanDerWaalsContact O-CG2 3.31Å; M33-V37 WeakPolarHBondContact O-CG2 3.36Å; M33-V37 PolarHBondContact O-N 3.4Å
34	R	98.1	Very high	97.4	Very high	157 Å²	157	96.9 Å²	96.9	59%	0.592	50%	0.496	S	S	*	.	H	α-helix	trans	-58.9	-49	170.7	-73.9	176.6	-170.2	170.2	3.8	111.2	V30 D31 I32 N36 V37 D38	V30-R34 WeakPolarHBondContact O-CG 3.31Å; V30-R34 PolarHBondContact O-N 3.01Å; D31-R34 PolarHBondContact O-N 3.29Å; D31-R34 IonicContact OD1-CZ 3.91Å; D31-R34 IonicContact OD1-NH1 3.49Å; D31-R34 PolarHBondContact OD1-NH1 3.35Å; I32-R34 PolarHBondContact O-N 3.25Å; R34-N36 VanDerWaalsContact C-N 3.27Å; R34-N36 PolarHBondContact O-N 3.45Å; R34-V37 WeakPolarHBondContact O-CB 3.29Å; R34-V37 PolarHBondContact O-N 2.85Å; R34-V37 VanDerWaalsContact O-N 3.11Å; R34-D38 PolarHBondContact O-N 2.94Å
35	V	98	Very high	97.6	Very high	69 Å²	69	100.4 Å²	100.4	42%	0.418	50%	0.501	S	S	.	.	H	α-helix	trans	-61.4	-38.1	176.4	175.9	0	0	0	0	111.4	D31 I32 D38 K39	D31-V35 PolarHBondContact O-N 3.5Å; I32-V35 PolarHBondContact O-N 2.85Å; V35-D38 PolarHBondContact O-N 3.38Å; V35-K39 HydrophobicContact CG1-CD 4.17Å; V35-K39 VanDerWaalsContact O-CG 3.29Å; V35-K39 WeakPolarHBondContact O-CG 3.4Å; V35-K39 PolarHBondContact O-N 3.31Å
36	N	97.7	Very high	97.7	Very high	66 Å²	66	98.3 Å²	98.3	35%	0.353	49%	0.494	S	S	.	.	H	α-helix	trans	-68.5	-34.8	176.5	-69.7	-16.3	0	0	0	112.4	I32 M33 R34 K39 V40	I32-N36 VanDerWaalsContact O-CG 3.29Å; I32-N36 PolarHBondContact O-N 3.33Å; M33-N36 PolarHBondContact O-N 3.02Å; M33-N36 HydrophobicContact SD-CB 4.47Å; R34-N36 VanDerWaalsContact C-N 3.27Å; R34-N36 PolarHBondContact O-N 3.45Å; N36-K39 PolarHBondContact O-N 2.92Å; N36-V40 WeakPolarHBondContact O-CG1 3.32Å; N36-V40 PolarHBondContact O-N 3.35Å
37	V	98.5	Very high	97.9	Very high	73 Å²	73	99 Å²	99	44%	0.442	49%	0.494	S	S	.	.	H	α-helix	trans	-61.5	-46.6	172.8	168.9	0	0	0	0	110.2	M33 R34 K39 V40 L41	M33-V37 VanDerWaalsContact O-CG2 3.31Å; M33-V37 WeakPolarHBondContact O-CG2 3.36Å; M33-V37 PolarHBondContact O-N 3.4Å; R34-V37 WeakPolarHBondContact O-CB 3.29Å; R34-V37 PolarHBondContact O-N 2.85Å; R34-V37 VanDerWaalsContact O-N 3.11Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.42Å; V37-V40 WeakPolarHBondContact O-CG1 3.17Å; V37-V40 PolarHBondContact O-N 3.03Å; V37-L41 HydrophobicContact CG1-CD1 4.16Å; V37-L41 WeakPolarHBondContact O-CG 3.31Å; V37-L41 PolarHBondContact O-N 3.27Å
38	D	98.2	Very high	98	Very high	108 Å²	108	99.1 Å²	99.1	58%	0.578	50%	0.501	S	S	*	.	H	α-helix	trans	-61.5	-42	176.5	-63.4	-27.4	0	0	0	111.5	R34 V35 L41 E42	R34-D38 PolarHBondContact O-N 2.94Å; V35-D38 PolarHBondContact O-N 3.38Å; D38-L41 PolarHBondContact O-N 2.94Å; D38-E42 PolarHBondContact O-N 3.14Å
39	K	98.5	Very high	98.1	Very high	131 Å²	131	97.8 Å²	97.8	57%	0.57	50%	0.495	S	S	*	.	H	α-helix	trans	-64.9	-38.9	176.9	-73.7	172.1	-179.5	172.2	0	113.1	V35 N36 V37 R43	V35-K39 HydrophobicContact CG1-CD 4.17Å; V35-K39 VanDerWaalsContact O-CG 3.29Å; V35-K39 WeakPolarHBondContact O-CG 3.4Å; V35-K39 PolarHBondContact O-N 3.31Å; N36-K39 PolarHBondContact O-N 2.92Å; V37-K39 VanDerWaalsContact C-N 3.31Å; V37-K39 PolarHBondContact O-N 3.42Å; K39-R43 WeakPolarHBondContact O-CB 3.49Å; K39-R43 PolarHBondContact O-N 2.85Å
40	V	98.3	Very high	98.2	Very high	84 Å²	84	98.8 Å²	98.8	51%	0.509	50%	0.497	S	S	.	.	H	α-helix	trans	-72.1	-33.4	178.7	69.6	0	0	0	0	111.3	N36 V37 R43 D44	N36-V40 WeakPolarHBondContact O-CG1 3.32Å; N36-V40 PolarHBondContact O-N 3.35Å; V37-V40 WeakPolarHBondContact O-CG1 3.17Å; V37-V40 PolarHBondContact O-N 3.03Å; V40-R43 WeakPolarHBondContact O-CB 3.3Å; V40-R43 PolarHBondContact O-N 3.48Å; V40-D44 WeakPolarHBondContact O-CB 3.47Å; V40-D44 PolarHBondContact O-N 3.2Å
41	L	98.3	Very high	98.2	Very high	107 Å²	107	100.8 Å²	100.8	56%	0.56	51%	0.506	S	S	*	.	H	α-helix	trans	-65.9	-42.8	173.1	-69.3	173.2	0	0	0	111.7	V37 D38 R43 D44 K45	V37-L41 HydrophobicContact CG1-CD1 4.16Å; V37-L41 WeakPolarHBondContact O-CG 3.31Å; V37-L41 PolarHBondContact O-N 3.27Å; D38-L41 PolarHBondContact O-N 2.94Å; L41-R43 VanDerWaalsContact C-N 3.32Å; L41-R43 PolarHBondContact O-N 2.83Å; L41-D44 WeakPolarHBondContact O-CB 3.46Å; L41-D44 PolarHBondContact O-N 3.24Å; L41-K45 PolarHBondContact O-N 2.8Å; L41-K45 VanDerWaalsContact O-N 3.14Å
42	E	98.5	Very high	98.3	Very high	99 Å²	99	98.8 Å²	98.8	46%	0.463	51%	0.505	S	S	.	.	H	α-helix	trans	-65.2	-38.3	174	-176.4	54.1	-147.5	0	0	111.3	D38 D44 K45 N46	D38-E42 PolarHBondContact O-N 3.14Å; E42-D44 VanDerWaalsContact C-N 3.35Å; E42-D44 PolarHBondContact O-N 3.44Å; E42-K45 PolarHBondContact O-N 3.04Å; E42-N46 PolarHBondContact O-N 2.86Å; E42-N46 PolarHBondContact O-ND2 3.02Å; E42-N46 PolarHBondContact OE1-ND2 3.27Å
43	R	98.5	Very high	98.3	Very high	165 Å²	165	102.3 Å²	102.3	62%	0.623	51%	0.513	S	S	*	.	H	α-helix	trans	-61.9	-42.1	173.4	-179.1	179.4	176.8	138	1.1	111.8	K39 V40 L41 N46 L47	K39-R43 WeakPolarHBondContact O-CB 3.49Å; K39-R43 PolarHBondContact O-N 2.85Å; V40-R43 WeakPolarHBondContact O-CB 3.3Å; V40-R43 PolarHBondContact O-N 3.48Å; L41-R43 VanDerWaalsContact C-N 3.32Å; L41-R43 PolarHBondContact O-N 2.83Å; R43-N46 PolarHBondContact O-N 2.85Å; R43-L47 HydrophobicContact CG-CD1 3.95Å; R43-L47 HydrophobicContact CG-CG 4.2Å; R43-L47 WeakPolarHBondContact O-CB 3.42Å; R43-L47 VanDerWaalsContact O-CG 3.3Å; R43-L47 WeakPolarHBondContact O-CG 3.48Å; R43-L47 PolarHBondContact O-N 2.63Å
44	D	98.5	Very high	98.4	Very high	110 Å²	110	99.6 Å²	99.6	59%	0.588	51%	0.506	S	S	*	.	H	α-helix	trans	-59.2	-46.8	178.6	-174	71.2	0	0	0	111.2	V40 L41 E42 N46 L47 S48	V40-D44 WeakPolarHBondContact O-CB 3.47Å; V40-D44 PolarHBondContact O-N 3.2Å; L41-D44 WeakPolarHBondContact O-CB 3.46Å; L41-D44 PolarHBondContact O-N 3.24Å; E42-D44 VanDerWaalsContact C-N 3.35Å; E42-D44 PolarHBondContact O-N 3.44Å; D44-N46 PolarHBondContact O-N 3.32Å; D44-L47 PolarHBondContact O-N 3.32Å; D44-S48 PolarHBondContact O-N 3.23Å
45	K	98.4	Very high	98.4	Very high	133 Å²	133	96.6 Å²	96.6	58%	0.578	50%	0.502	S	S	*	.	H	α-helix	trans	-58.3	-48.2	174	-177.6	-179.2	177.1	178.3	0	112.6	L41 E42 L47 S48 E49	L41-K45 PolarHBondContact O-N 2.8Å; L41-K45 VanDerWaalsContact O-N 3.14Å; E42-K45 PolarHBondContact O-N 3.04Å; K45-L47 VanDerWaalsContact C-N 3.3Å; K45-L47 PolarHBondContact O-N 3.45Å; K45-S48 PolarHBondContact O-N 3.28Å; K45-E49 PolarHBondContact O-N 3.49Å
46	N	98.5	Very high	98.4	Very high	77 Å²	77	96.5 Å²	96.5	41%	0.412	51%	0.508	S	S	.	.	H	α-helix	trans	-64.3	-35.6	179	-74.7	-57	0	0	0	112.3	E42 R43 D44 L50	E42-N46 PolarHBondContact O-N 2.86Å; E42-N46 PolarHBondContact O-ND2 3.02Å; E42-N46 PolarHBondContact OE1-ND2 3.27Å; R43-N46 PolarHBondContact O-N 2.85Å; D44-N46 PolarHBondContact O-N 3.32Å; N46-L50 VanDerWaalsContact O-CB 3.28Å; N46-L50 WeakPolarHBondContact O-CB 3.29Å; N46-L50 PolarHBondContact O-N 2.9Å
47	L	98.7	Very high	98.5	Very high	84 Å²	84	99.3 Å²	99.3	44%	0.44	52%	0.523	S	S	.	.	H	α-helix	trans	-69.4	-41.2	175.6	-74.8	175.9	0	0	0	111.8	R43 D44 K45 E49 L50 D51	R43-L47 HydrophobicContact CG-CD1 3.95Å; R43-L47 HydrophobicContact CG-CG 4.2Å; R43-L47 WeakPolarHBondContact O-CB 3.42Å; R43-L47 VanDerWaalsContact O-CG 3.3Å; R43-L47 WeakPolarHBondContact O-CG 3.48Å; R43-L47 PolarHBondContact O-N 2.63Å; D44-L47 PolarHBondContact O-N 3.32Å; K45-L47 VanDerWaalsContact C-N 3.3Å; K45-L47 PolarHBondContact O-N 3.45Å; L47-E49 VanDerWaalsContact C-N 3.33Å; L47-E49 PolarHBondContact O-N 3.45Å; L47-L50 PolarHBondContact O-N 2.8Å; L47-D51 VanDerWaalsContact O-CB 3.3Å; L47-D51 WeakPolarHBondContact O-CB 3.49Å; L47-D51 PolarHBondContact O-N 3.44Å
48	S	98.5	Very high	98.5	Very high	82 Å²	82	102.5 Å²	102.5	57%	0.573	53%	0.533	S	S	*	.	H	α-helix	trans	-62.5	-40.5	175.1	179.9	0	0	0	0	111.9	D44 K45 D51 G52	D44-S48 PolarHBondContact O-N 3.23Å; K45-S48 PolarHBondContact O-N 3.28Å; S48-D51 PolarHBondContact O-N 2.92Å; S48-G52 PolarHBondContact O-N 2.96Å; S48-G52 VanDerWaalsContact O-N 3.11Å
49	E	98.5	Very high	98.5	Very high	94 Å²	94	100.4 Å²	100.4	44%	0.439	53%	0.53	S	S	.	.	H	α-helix	trans	-65.5	-42.9	173.2	-176.7	177.3	-178.7	0	0	111.8	K45 L47 D51 G52 R53	K45-E49 PolarHBondContact O-N 3.49Å; L47-E49 VanDerWaalsContact C-N 3.33Å; L47-E49 PolarHBondContact O-N 3.45Å; E49-D51 VanDerWaalsContact C-N 3.34Å; E49-G52 PolarHBondContact O-N 3.48Å; E49-R53 WeakPolarHBondContact O-CB 3.3Å; E49-R53 VanDerWaalsContact O-CG 3.29Å; E49-R53 WeakPolarHBondContact O-CG 3.42Å; E49-R53 PolarHBondContact O-N 3.49Å; E49-R53 IonicContact OE1-CZ 3.19Å; E49-R53 IonicContact OE1-NE 3.2Å; E49-R53 PolarHBondContact OE1-NE 3.11Å; E49-R53 IonicContact OE1-NH2 2.63Å; E49-R53 PolarHBondContact OE1-NH2 2.91Å
50	L	98.6	Very high	98.5	Very high	104 Å²	104	96 Å²	96	55%	0.545	52%	0.522	S	S	.	.	H	α-helix	trans	-63.3	-40.1	177.6	-179	63.1	0	0	0	112	N46 L47 R53 A54	N46-L50 VanDerWaalsContact O-CB 3.28Å; N46-L50 WeakPolarHBondContact O-CB 3.29Å; N46-L50 PolarHBondContact O-N 2.9Å; L47-L50 PolarHBondContact O-N 2.8Å; L50-R53 CarbonylContact O-C 3.6Å; L50-R53 PolarHBondContact O-N 2.93Å; L50-A54 WeakPolarHBondContact O-CB 3.28Å; L50-A54 PolarHBondContact O-N 3.23Å
51	D	98.4	Very high	98.5	Very high	103 Å²	103	94.5 Å²	94.5	55%	0.551	52%	0.519	S	S	*	.	H	α-helix	trans	-61.4	-49.5	176.8	-168.4	59.8	0	0	0	110.7	L47 S48 E49 R53 A54 D55	L47-D51 VanDerWaalsContact O-CB 3.3Å; L47-D51 WeakPolarHBondContact O-CB 3.49Å; L47-D51 PolarHBondContact O-N 3.44Å; S48-D51 PolarHBondContact O-N 2.92Å; E49-D51 VanDerWaalsContact C-N 3.34Å; D51-R53 VanDerWaalsContact C-N 3.3Å; D51-R53 PolarHBondContact O-N 3.04Å; D51-A54 WeakPolarHBondContact O-CB 3.49Å; D51-A54 PolarHBondContact O-N 3.3Å; D51-D55 PolarHBondContact O-N 3.28Å
52	G	98.2	Very high	98.5	Very high	42 Å²	42	92.8 Å²	92.8	43%	0.433	52%	0.516	S	S	.	.	H	α-helix	trans	-60.9	-36.7	174.4	0	0	0	0	0	113.4	S48 E49 A56	S48-G52 PolarHBondContact O-N 2.96Å; S48-G52 VanDerWaalsContact O-N 3.11Å; E49-G52 PolarHBondContact O-N 3.48Å; G52-A56 WeakPolarHBondContact O-CB 3.35Å; G52-A56 PolarHBondContact O-N 3.14Å; G52-A56 VanDerWaalsContact O-N 3.14Å
53	R	98.5	Very high	98.5	Very high	158 Å²	158	95 Å²	95	60%	0.596	53%	0.526	S	S	*	.	H	α-helix	trans	-68.5	-36.6	173.3	-72.8	174.6	179.4	-158.8	2.1	112.1	E49 L50 D51 A56 L57	E49-R53 WeakPolarHBondContact O-CB 3.3Å; E49-R53 VanDerWaalsContact O-CG 3.29Å; E49-R53 WeakPolarHBondContact O-CG 3.42Å; E49-R53 PolarHBondContact O-N 3.49Å; E49-R53 IonicContact OE1-CZ 3.19Å; E49-R53 IonicContact OE1-NE 3.2Å; E49-R53 PolarHBondContact OE1-NE 3.11Å; E49-R53 IonicContact OE1-NH2 2.63Å; E49-R53 PolarHBondContact OE1-NH2 2.91Å; L50-R53 CarbonylContact O-C 3.6Å; L50-R53 PolarHBondContact O-N 2.93Å; D51-R53 VanDerWaalsContact C-N 3.3Å; D51-R53 PolarHBondContact O-N 3.04Å; R53-A56 PolarHBondContact O-N 3.3Å; R53-L57 VanDerWaalsContact O-CB 3.29Å; R53-L57 WeakPolarHBondContact O-CB 3.29Å; R53-L57 PolarHBondContact O-N 2.8Å
54	A	98.7	Very high	98.5	Very high	45 Å²	45	94.2 Å²	94.2	37%	0.372	53%	0.527	S	S	.	.	H	α-helix	trans	-67	-42.9	178.2	0	0	0	0	0	111.1	L50 D51 L57 Q58	L50-A54 WeakPolarHBondContact O-CB 3.28Å; L50-A54 PolarHBondContact O-N 3.23Å; D51-A54 WeakPolarHBondContact O-CB 3.49Å; D51-A54 PolarHBondContact O-N 3.3Å; A54-L57 PolarHBondContact O-N 3.36Å; A54-Q58 WeakPolarHBondContact O-CB 3.36Å; A54-Q58 PolarHBondContact O-N 2.79Å
55	D	98.5	Very high	98.5	Very high	95 Å²	95	95.7 Å²	95.7	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-59.7	-47.7	173.4	-82.1	-13.2	0	0	0	111.8	D51 L57 Q58 A59	D51-D55 PolarHBondContact O-N 3.28Å; D55-L57 VanDerWaalsContact C-N 3.32Å; D55-L57 PolarHBondContact O-N 2.93Å; D55-Q58 PolarHBondContact O-N 3.49Å; D55-A59 WeakPolarHBondContact O-CB 3.25Å; D55-A59 PolarHBondContact O-N 2.94Å
56	A	98.5	Very high	98.5	Very high	66 Å²	66	92.3 Å²	92.3	55%	0.545	53%	0.527	S	S	.	.	H	α-helix	trans	-61.3	-41.1	176.9	0	0	0	0	0	111.9	G52 R53 G60	G52-A56 WeakPolarHBondContact O-CB 3.35Å; G52-A56 PolarHBondContact O-N 3.14Å; G52-A56 VanDerWaalsContact O-N 3.14Å; R53-A56 PolarHBondContact O-N 3.3Å; A56-G60 PolarHBondContact O-N 3.42Å
57	L	98.6	Very high	98.5	Very high	126 Å²	126	91.9 Å²	91.9	66%	0.66	53%	0.53	S	S	*	.	H	α-helix	trans	-65.2	-43.8	176.5	178.7	62.8	0	0	0	111.6	R53 A54 D55 G60 A61	R53-L57 VanDerWaalsContact O-CB 3.29Å; R53-L57 WeakPolarHBondContact O-CB 3.29Å; R53-L57 PolarHBondContact O-N 2.8Å; A54-L57 PolarHBondContact O-N 3.36Å; D55-L57 VanDerWaalsContact C-N 3.32Å; D55-L57 PolarHBondContact O-N 2.93Å; L57-G60 PolarHBondContact O-N 2.9Å; L57-A61 VanDerWaalsContact O-CB 3.25Å; L57-A61 WeakPolarHBondContact O-CB 3.44Å; L57-A61 PolarHBondContact O-N 2.83Å
58	Q	98.7	Very high	98.5	Very high	140 Å²	140	89.8 Å²	89.8	65%	0.654	53%	0.526	S	S	*	.	H	α-helix	trans	-62.4	-45.5	178.1	179	175.8	-18.1	0	0	111.2	A54 D55 A61 S62	A54-Q58 WeakPolarHBondContact O-CB 3.36Å; A54-Q58 PolarHBondContact O-N 2.79Å; D55-Q58 PolarHBondContact O-N 3.49Å; Q58-A61 PolarHBondContact O-N 3.27Å; Q58-S62 WeakPolarHBondContact O-CB 3.3Å; Q58-S62 PolarHBondContact O-N 2.8Å
59	A	98.3	Very high	98.5	Very high	63 Å²	63	86.9 Å²	86.9	52%	0.521	51%	0.508	S	S	.	.	H	α-helix	trans	-61.6	-45.5	175.7	0	0	0	0	0	111.6	D55 S62 Q63	D55-A59 WeakPolarHBondContact O-CB 3.25Å; D55-A59 PolarHBondContact O-N 2.94Å; A59-S62 PolarHBondContact O-N 2.99Å; A59-Q63 PolarHBondContact O-N 3.01Å
60	G	98.4	Very high	98.5	Very high	38 Å²	38	89.6 Å²	89.6	39%	0.392	52%	0.519	S	S	.	.	H	α-helix	trans	-61	-43.4	175.7	0	0	0	0	0	112.8	A56 L57 Q63 F64	A56-G60 PolarHBondContact O-N 3.42Å; L57-G60 PolarHBondContact O-N 2.9Å; G60-Q63 PolarHBondContact O-N 3.41Å; G60-F64 WeakPolarHBondContact O-CB 3.4Å; G60-F64 PolarHBondContact O-N 3.34Å
61	A	98.7	Very high	98.4	Very high	53 Å²	53	89.2 Å²	89.2	44%	0.438	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-43.4	177.7	0	0	0	0	0	111.9	L57 Q58 F64 E65	L57-A61 VanDerWaalsContact O-CB 3.25Å; L57-A61 WeakPolarHBondContact O-CB 3.44Å; L57-A61 PolarHBondContact O-N 2.83Å; Q58-A61 PolarHBondContact O-N 3.27Å; A61-F64 PolarHBondContact O-N 3.38Å; A61-E65 WeakPolarHBondContact O-CB 3.45Å; A61-E65 PolarHBondContact O-N 3.46Å
62	S	98.5	Very high	98.4	Very high	72 Å²	72	92.4 Å²	92.4	50%	0.503	53%	0.525	S	S	.	.	H	α-helix	trans	-62.8	-43.4	176.1	-175.7	0	0	0	0	111.9	Q58 A59 F64 E65 A66	Q58-S62 WeakPolarHBondContact O-CB 3.3Å; Q58-S62 PolarHBondContact O-N 2.8Å; A59-S62 PolarHBondContact O-N 2.99Å; S62-F64 VanDerWaalsContact C-N 3.35Å; S62-F64 PolarHBondContact O-N 3.41Å; S62-E65 PolarHBondContact O-N 3.48Å; S62-A66 WeakPolarHBondContact O-CB 3.48Å; S62-A66 PolarHBondContact O-N 3.29Å
63	Q	98.5	Very high	98.5	Very high	144 Å²	144	97.2 Å²	97.2	67%	0.673	53%	0.531	S	S	*	.	H	α-helix	trans	-64.6	-39.8	175.6	-175.3	176.2	73.3	0	0	112.1	A59 G60 S67	A59-Q63 PolarHBondContact O-N 3.01Å; G60-Q63 PolarHBondContact O-N 3.41Å; Q63-S67 VanDerWaalsContact O-CB 3.3Å; Q63-S67 WeakPolarHBondContact O-CB 3.29Å; Q63-S67 PolarHBondContact O-N 3Å; Q63-S67 PolarHBondContact O-OG 3.27Å
64	F	98.2	Very high	98.5	Very high	149 Å²	149	95.4 Å²	95.4	65%	0.654	53%	0.527	S	S	*	.	H	α-helix	trans	-63.2	-46.8	175.2	178.2	-98.1	0	0	0	111.4	G60 A61 S62 A66 S67 A68	G60-F64 WeakPolarHBondContact O-CB 3.4Å; G60-F64 PolarHBondContact O-N 3.34Å; A61-F64 PolarHBondContact O-N 3.38Å; S62-F64 VanDerWaalsContact C-N 3.35Å; S62-F64 PolarHBondContact O-N 3.41Å; F64-A66 PolarHBondContact O-N 2.93Å; F64-S67 PolarHBondContact O-N 2.78Å; F64-A68 VanDerWaalsContact O-CB 3.29Å; F64-A68 WeakPolarHBondContact O-CB 3.46Å; F64-A68 PolarHBondContact O-N 3.22Å
65	E	98.6	Very high	98.4	Very high	142 Å²	142	98.1 Å²	98.1	66%	0.664	53%	0.531	S	S	*	.	H	α-helix	trans	-57.7	-49	176.7	-174.8	-170.5	-171.5	0	0	111.4	A61 S62 S67 A68 G69	A61-E65 WeakPolarHBondContact O-CB 3.45Å; A61-E65 PolarHBondContact O-N 3.46Å; S62-E65 PolarHBondContact O-N 3.48Å; E65-S67 VanDerWaalsContact C-N 3.3Å; E65-S67 PolarHBondContact O-N 2.86Å; E65-A68 PolarHBondContact O-N 2.86Å; E65-G69 PolarHBondContact O-N 3.25Å
66	A	98.5	Very high	98.4	Very high	61 Å²	61	100.5 Å²	100.5	50%	0.504	53%	0.533	S	S	.	.	H	α-helix	trans	-59.4	-42.8	177.9	0	0	0	0	0	111.8	S62 F64 G69 K70	S62-A66 WeakPolarHBondContact O-CB 3.48Å; S62-A66 PolarHBondContact O-N 3.29Å; F64-A66 PolarHBondContact O-N 2.93Å; A66-G69 PolarHBondContact O-N 2.97Å; A66-K70 PolarHBondContact O-N 2.85Å
67	S	98.2	Very high	98.4	Very high	68 Å²	68	104.3 Å²	104.3	48%	0.476	53%	0.533	S	S	.	.	H	α-helix	trans	-67.3	-44.3	178.6	-61.8	0	0	0	0	112.1	Q63 F64 E65 G69 K70 L71	Q63-S67 VanDerWaalsContact O-CB 3.3Å; Q63-S67 WeakPolarHBondContact O-CB 3.29Å; Q63-S67 PolarHBondContact O-N 3Å; Q63-S67 PolarHBondContact O-OG 3.27Å; F64-S67 PolarHBondContact O-N 2.78Å; E65-S67 VanDerWaalsContact C-N 3.3Å; E65-S67 PolarHBondContact O-N 2.86Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.5Å; S67-K70 PolarHBondContact O-N 3.33Å; S67-L71 WeakPolarHBondContact O-CB 3.4Å; S67-L71 PolarHBondContact O-N 3.4Å
68	A	98.5	Very high	98.4	Very high	41 Å²	41	103.6 Å²	103.6	34%	0.339	53%	0.525	S	S	.	.	H	α-helix	trans	-61.9	-42.2	175.2	0	0	0	0	0	111.2	F64 E65 K70 L71 K72	F64-A68 VanDerWaalsContact O-CB 3.29Å; F64-A68 WeakPolarHBondContact O-CB 3.46Å; F64-A68 PolarHBondContact O-N 3.22Å; E65-A68 PolarHBondContact O-N 2.86Å; A68-K70 PolarHBondContact O-N 3.37Å; A68-L71 PolarHBondContact O-N 3.02Å; A68-K72 WeakPolarHBondContact O-CB 3.4Å; A68-K72 PolarHBondContact O-N 3.04Å
69	G	98.4	Very high	98.3	Very high	20 Å²	20	102.2 Å²	102.2	21%	0.206	52%	0.522	C	S	.	.	H	α-helix	trans	-60.7	-44.1	173.6	0	0	0	0	0	112.6	E65 A66 S67 K72 R73	E65-G69 PolarHBondContact O-N 3.25Å; A66-G69 PolarHBondContact O-N 2.97Å; S67-G69 VanDerWaalsContact C-N 3.34Å; S67-G69 PolarHBondContact O-N 3.5Å; G69-K72 PolarHBondContact O-N 3.49Å; G69-R73 WeakPolarHBondContact O-CG 3.4Å; G69-R73 PolarHBondContact O-N 3.46Å; G69-R73 PolarHBondContact O-NH1 3.49Å
70	K	98.2	Very high	98.3	Very high	152 Å²	152	101.4 Å²	101.4	66%	0.661	51%	0.512	S	S	*	.	H	α-helix	trans	-63.4	-41.9	174.8	-173.6	178	-178.3	177.8	0	111.7	A66 S67 A68 R73 K74	A66-K70 PolarHBondContact O-N 2.85Å; S67-K70 PolarHBondContact O-N 3.33Å; A68-K70 PolarHBondContact O-N 3.37Å; K70-R73 PolarHBondContact O-N 2.84Å; K70-K74 WeakPolarHBondContact O-CB 3.45Å; K70-K74 PolarHBondContact O-N 3.16Å
71	L	98.5	Very high	98.3	Very high	96 Å²	96	106.8 Å²	106.8	50%	0.503	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-47.9	177.9	-169.1	63.4	0	0	0	111.3	S67 A68 R73 K74 F75	S67-L71 WeakPolarHBondContact O-CB 3.4Å; S67-L71 PolarHBondContact O-N 3.4Å; A68-L71 PolarHBondContact O-N 3.02Å; L71-R73 VanDerWaalsContact C-N 3.34Å; L71-R73 PolarHBondContact O-N 2.93Å; L71-K74 WeakPolarHBondContact O-CB 3.41Å; L71-K74 PolarHBondContact O-N 3.42Å; L71-K74 VanDerWaalsContact O-N 3.16Å; L71-F75 HydrophobicContact CD1-CD2 3.92Å; L71-F75 HydrophobicContact CD1-CE2 3.58Å; L71-F75 HydrophobicContact CG-CD2 4.06Å; L71-F75 HydrophobicContact CG-CE2 4.06Å; L71-F75 WeakPolarHBondContact O-CD2 3.41Å; L71-F75 PolarHBondContact O-N 3.46Å
72	K	98.4	Very high	98.2	Very high	169 Å²	169	111.1 Å²	111.1	74%	0.735	53%	0.53	S	S	*	.	H	α-helix	trans	-54.6	-49.4	174.8	-178.4	177.9	178.7	178.2	0	111.1	A68 G69 K74 F75 W76	A68-K72 WeakPolarHBondContact O-CB 3.4Å; A68-K72 PolarHBondContact O-N 3.04Å; G69-K72 PolarHBondContact O-N 3.49Å; K72-K74 PolarHBondContact O-N 3.08Å; K72-F75 PolarHBondContact O-N 3.44Å; K72-W76 VanDerWaalsContact O-CB 3.31Å; K72-W76 WeakPolarHBondContact O-CB 3.42Å; K72-W76 PolarHBondContact O-N 3.46Å
73	R	98.4	Very high	98.2	Very high	143 Å²	143	108.9 Å²	108.9	54%	0.54	52%	0.519	S	S	.	.	H	α-helix	trans	-61.4	-42.3	177.3	-72.8	-173.6	-65.3	-89.3	3.5	112.4	G69 K70 L71 F75 W76 W77	G69-R73 WeakPolarHBondContact O-CG 3.4Å; G69-R73 PolarHBondContact O-N 3.46Å; G69-R73 PolarHBondContact O-NH1 3.49Å; K70-R73 PolarHBondContact O-N 2.84Å; L71-R73 VanDerWaalsContact C-N 3.34Å; L71-R73 PolarHBondContact O-N 2.93Å; R73-F75 PolarHBondContact O-N 3.25Å; R73-W76 PolarHBondContact O-N 2.97Å; R73-W77 PolarHBondContact O-N 3.36Å
74	K	98.4	Very high	98.2	Very high	121 Å²	121	105.4 Å²	105.4	53%	0.526	51%	0.511	S	S	.	.	H	α-helix	trans	-57.8	-47.7	177.3	-179.3	-178.8	-179.2	179.7	0	111.3	K70 L71 K72 K78	K70-K74 WeakPolarHBondContact O-CB 3.45Å; K70-K74 PolarHBondContact O-N 3.16Å; L71-K74 WeakPolarHBondContact O-CB 3.41Å; L71-K74 PolarHBondContact O-N 3.42Å; L71-K74 VanDerWaalsContact O-N 3.16Å; K72-K74 PolarHBondContact O-N 3.08Å; K74-K78 WeakPolarHBondContact O-CG 3.31Å; K74-K78 PolarHBondContact O-N 2.89Å; K74-K78 VanDerWaalsContact O-N 3.08Å
75	F	98.1	Very high	98.2	Very high	102 Å²	102	103.8 Å²	103.8	45%	0.447	50%	0.504	S	S	.	.	H	α-helix	trans	-73.3	-35.6	179.3	-81.4	-79.5	0	0	0	113	L71 K72 R73 W77 K78 N79	L71-F75 HydrophobicContact CD1-CD2 3.92Å; L71-F75 HydrophobicContact CD1-CE2 3.58Å; L71-F75 HydrophobicContact CG-CD2 4.06Å; L71-F75 HydrophobicContact CG-CE2 4.06Å; L71-F75 WeakPolarHBondContact O-CD2 3.41Å; L71-F75 PolarHBondContact O-N 3.46Å; K72-F75 PolarHBondContact O-N 3.44Å; R73-F75 PolarHBondContact O-N 3.25Å; F75-W77 PolarHBondContact O-N 2.85Å; F75-K78 HydrophobicContact CD1-CD 4.43Å; F75-K78 PolarHBondContact O-N 3.39Å; F75-N79 WeakPolarHBondContact O-CB 3.33Å; F75-N79 PolarHBondContact O-N 3.3Å; F75-N79 PolarHBondContact O-OD1 3.2Å
76	W	98.3	Very high	98.2	Very high	145 Å²	145	100.3 Å²	100.3	55%	0.549	49%	0.489	S	S	.	.	H	α-helix	trans	-56.9	-49.5	172.5	-176.6	77.3	0	0	0	111.3	K72 R73 K78 N79 C80	K72-W76 VanDerWaalsContact O-CB 3.31Å; K72-W76 WeakPolarHBondContact O-CB 3.42Å; K72-W76 PolarHBondContact O-N 3.46Å; R73-W76 PolarHBondContact O-N 2.97Å; W76-K78 PolarHBondContact O-N 3.45Å; W76-N79 PolarHBondContact O-N 2.87Å; W76-C80 PolarHBondContact O-N 3.46Å; W76-C80 PolarHBondContact O-SG 3.34Å
77	W	98.2	Very high	98.2	Very high	145 Å²	145	102.1 Å²	102.1	55%	0.549	49%	0.49	S	S	.	.	H	α-helix	trans	-63.8	-38.8	176.1	-78.8	119	0	0	0	113.7	R73 F75 N79 K81	R73-W77 PolarHBondContact O-N 3.36Å; F75-W77 PolarHBondContact O-N 2.85Å; W77-N79 VanDerWaalsContact C-N 3.35Å; W77-K81 WeakPolarHBondContact O-CB 3.41Å; W77-K81 VanDerWaalsContact O-CG 3.29Å; W77-K81 WeakPolarHBondContact O-CG 3.49Å; W77-K81 PolarHBondContact O-N 3.46Å
78	K	97.9	Very high	98.2	Very high	111 Å²	111	106.3 Å²	106.3	48%	0.483	50%	0.5	S	S	.	.	H	α-helix	trans	-60.3	-46.5	174	-79.3	-175.3	171.6	-165.6	0	111.1	K74 F75 W76 K81 Y82	K74-K78 WeakPolarHBondContact O-CG 3.31Å; K74-K78 PolarHBondContact O-N 2.89Å; K74-K78 VanDerWaalsContact O-N 3.08Å; F75-K78 HydrophobicContact CD1-CD 4.43Å; F75-K78 PolarHBondContact O-N 3.39Å; W76-K78 PolarHBondContact O-N 3.45Å; K78-K81 PolarHBondContact O-N 3.24Å; K78-Y82 WeakPolarHBondContact O-CB 3.29Å; K78-Y82 PolarHBondContact O-N 2.87Å
79	N	97.7	Very high	98.2	Very high	111 Å²	111	110.1 Å²	110.1	59%	0.594	51%	0.509	S	S	*	.	H	α-helix	trans	-66.1	-42.6	179.9	-68.4	-6.2	0	0	0	111.5	F75 W76 W77 Y82 G83	F75-N79 WeakPolarHBondContact O-CB 3.33Å; F75-N79 PolarHBondContact O-N 3.3Å; F75-N79 PolarHBondContact O-OD1 3.2Å; W76-N79 PolarHBondContact O-N 2.87Å; W77-N79 VanDerWaalsContact C-N 3.35Å; N79-Y82 PolarHBondContact O-N 3.22Å; N79-G83 PolarHBondContact O-N 2.96Å
80	C	97.6	Very high	98.2	Very high	47 Å²	47	114.5 Å²	114.5	32%	0.318	53%	0.526	S	S	.	.	H	α-helix	trans	-59.5	-48.3	174.1	-70.7	0	0	0	0	111.9	W76 Y82 G83 S84	W76-C80 PolarHBondContact O-N 3.46Å; W76-C80 PolarHBondContact O-SG 3.34Å; C80-Y82 PolarHBondContact O-N 2.99Å; C80-G83 PolarHBondContact O-N 2.96Å; C80-S84 PolarHBondContact O-N 3.48Å; C80-S84 PolarHBondContact O-OG 3.37Å
81	K	98	Very high	98.1	Very high	150 Å²	150	114.5 Å²	114.5	65%	0.652	53%	0.526	S	S	*	.	H	α-helix	trans	-61.9	-43.3	177.6	-73.9	178	-179.3	-175.6	0	112	W77 K78 S84 F85	W77-K81 WeakPolarHBondContact O-CB 3.41Å; W77-K81 VanDerWaalsContact O-CG 3.29Å; W77-K81 WeakPolarHBondContact O-CG 3.49Å; W77-K81 PolarHBondContact O-N 3.46Å; K78-K81 PolarHBondContact O-N 3.24Å; K81-S84 PolarHBondContact O-N 3.3Å; K81-F85 PolarHBondContact O-N 3.35Å
82	Y	98.3	Very high	98.1	Very high	144 Å²	144	114.7 Å²	114.7	57%	0.565	53%	0.527	S	S	*	.	H	α-helix	trans	-63.4	-42.4	177.3	-169.4	-110	0	0	0	111.4	K78 N79 C80 S84 F85 L86	K78-Y82 WeakPolarHBondContact O-CB 3.29Å; K78-Y82 PolarHBondContact O-N 2.87Å; N79-Y82 PolarHBondContact O-N 3.22Å; C80-Y82 PolarHBondContact O-N 2.99Å; Y82-S84 PolarHBondContact O-N 3.16Å; Y82-F85 PolarHBondContact O-N 2.9Å; Y82-L86 HydrophobicContact CD1-CD1 3.35Å; Y82-L86 HydrophobicContact CD1-CG 4.17Å; Y82-L86 HydrophobicContact CE1-CD1 3.26Å; Y82-L86 HydrophobicContact CE1-CD2 4.31Å; Y82-L86 HydrophobicContact CE1-CG 3.9Å; Y82-L86 HydrophobicContact CG-CD1 4.19Å; Y82-L86 WeakPolarHBondContact O-CB 3.4Å; Y82-L86 WeakPolarHBondContact O-CD1 3.32Å; Y82-L86 WeakPolarHBondContact O-CG 3.44Å; Y82-L86 PolarHBondContact O-N 2.88Å
83	G	98.2	Very high	98.1	Very high	25 Å²	25	111.1 Å²	111.1	26%	0.258	52%	0.516	S	S	.	.	H	α-helix	trans	-58	-44.7	173.2	0	0	0	0	0	112.6	N79 C80 N87	N79-G83 PolarHBondContact O-N 2.96Å; C80-G83 PolarHBondContact O-N 2.96Å; G83-N87 PolarHBondContact O-N 3.3Å; G83-N87 VanDerWaalsContact O-N 3.09Å; G83-N87 PolarHBondContact O-ND2 2.85Å
84	S	98	Very high	98.1	Very high	72 Å²	72	112.2 Å²	112.2	50%	0.503	53%	0.525	S	S	.	.	H	α-helix	trans	-64.6	-39.6	175.1	-56.3	0	0	0	0	112.8	C80 K81 Y82 K88	C80-S84 PolarHBondContact O-N 3.48Å; C80-S84 PolarHBondContact O-OG 3.37Å; K81-S84 PolarHBondContact O-N 3.3Å; Y82-S84 PolarHBondContact O-N 3.16Å; S84-K88 WeakPolarHBondContact O-CG 3.5Å; S84-K88 PolarHBondContact O-N 3.47Å
85	F	97.8	Very high	98.1	Very high	115 Å²	115	110.9 Å²	110.9	50%	0.504	53%	0.527	S	S	.	.	H	α-helix	trans	-64.3	-47.2	177.1	175.5	-99	0	0	0	112.2	K81 Y82 N87 K88 K89	K81-F85 PolarHBondContact O-N 3.35Å; Y82-F85 PolarHBondContact O-N 2.9Å; F85-N87 PolarHBondContact O-N 2.98Å; F85-K88 PolarHBondContact O-N 3.34Å; F85-K89 HydrophobicContact CD1-CG 4.44Å; F85-K89 HydrophobicContact CE1-CG 3.95Å; F85-K89 HydrophobicContact CE2-CG 4.41Å; F85-K89 HydrophobicContact CZ-CD 4.44Å; F85-K89 HydrophobicContact CZ-CG 3.94Å; F85-K89 PolarHBondContact O-N 3.45Å
86	L	98.4	Very high	98	Very high	68 Å²	68	109.6 Å²	109.6	36%	0.356	53%	0.525	S	S	.	.	H	α-helix	trans	-55.7	-48.4	175	-81.4	157.9	0	0	0	111.8	Y82 K88 K89 I90	Y82-L86 HydrophobicContact CD1-CD1 3.35Å; Y82-L86 HydrophobicContact CD1-CG 4.17Å; Y82-L86 HydrophobicContact CE1-CD1 3.26Å; Y82-L86 HydrophobicContact CE1-CD2 4.31Å; Y82-L86 HydrophobicContact CE1-CG 3.9Å; Y82-L86 HydrophobicContact CG-CD1 4.19Å; Y82-L86 WeakPolarHBondContact O-CB 3.4Å; Y82-L86 WeakPolarHBondContact O-CD1 3.32Å; Y82-L86 WeakPolarHBondContact O-CG 3.44Å; Y82-L86 PolarHBondContact O-N 2.88Å; L86-K88 VanDerWaalsContact C-N 3.31Å; L86-K88 PolarHBondContact O-N 3.44Å; L86-K89 WeakPolarHBondContact O-CB 3.46Å; L86-K89 PolarHBondContact O-N 2.81Å; L86-K89 VanDerWaalsContact O-N 3.16Å; L86-I90 VanDerWaalsContact O-CG1 3.32Å; L86-I90 WeakPolarHBondContact O-CG1 3.49Å; L86-I90 PolarHBondContact O-N 3.09Å
87	N	98.4	Very high	98	Very high	99 Å²	99	106.7 Å²	106.7	53%	0.529	52%	0.519	S	S	.	.	H	α-helix	trans	-59.4	-40.7	178.6	-85.1	-74.4	0	0	0	112.4	G83 F85 I90 K91	G83-N87 PolarHBondContact O-N 3.3Å; G83-N87 VanDerWaalsContact O-N 3.09Å; G83-N87 PolarHBondContact O-ND2 2.85Å; F85-N87 PolarHBondContact O-N 2.98Å; N87-I90 PolarHBondContact O-N 2.93Å; N87-K91 WeakPolarHBondContact O-CG 3.45Å; N87-K91 PolarHBondContact O-N 3.22Å; N87-K91 VanDerWaalsContact O-N 3.07Å
88	K	98.2	Very high	98	Very high	157 Å²	157	105.4 Å²	105.4	68%	0.683	52%	0.519	S	S	*	.	H	α-helix	trans	-63.8	-45	174.8	-72.8	179.6	179.7	-175.5	0	111.7	S84 F85 L86 I90 K91 L92	S84-K88 WeakPolarHBondContact O-CG 3.5Å; S84-K88 PolarHBondContact O-N 3.47Å; F85-K88 PolarHBondContact O-N 3.34Å; L86-K88 VanDerWaalsContact C-N 3.31Å; L86-K88 PolarHBondContact O-N 3.44Å; K88-I90 VanDerWaalsContact C-N 3.35Å; K88-I90 PolarHBondContact O-N 2.98Å; K88-K91 PolarHBondContact O-N 3.21Å; K88-L92 WeakPolarHBondContact O-CB 3.37Å; K88-L92 PolarHBondContact O-N 3.18Å
89	K	98.1	Very high	97.9	Very high	121 Å²	121	105.8 Å²	105.8	53%	0.526	53%	0.525	S	S	.	.	H	α-helix	trans	-59.8	-43	176.4	-83.4	-77.5	-172.4	169.3	0	112.2	F85 L86 L92 N93	F85-K89 HydrophobicContact CD1-CG 4.44Å; F85-K89 HydrophobicContact CE1-CG 3.95Å; F85-K89 HydrophobicContact CE2-CG 4.41Å; F85-K89 HydrophobicContact CZ-CD 4.44Å; F85-K89 HydrophobicContact CZ-CG 3.94Å; F85-K89 PolarHBondContact O-N 3.45Å; L86-K89 WeakPolarHBondContact O-CB 3.46Å; L86-K89 PolarHBondContact O-N 2.81Å; L86-K89 VanDerWaalsContact O-N 3.16Å; K89-L92 PolarHBondContact O-N 3.41Å; K89-N93 WeakPolarHBondContact O-CB 3.47Å; K89-N93 PolarHBondContact O-N 3.47Å
90	I	98.4	Very high	97.8	Very high	111 Å²	111	107.2 Å²	107.2	57%	0.569	53%	0.532	S	S	*	.	H	α-helix	trans	-62.2	-47.4	177.2	-68.5	164.7	0	0	0	110.9	L86 N87 K88 L92 N93 K94	L86-I90 VanDerWaalsContact O-CG1 3.32Å; L86-I90 WeakPolarHBondContact O-CG1 3.49Å; L86-I90 PolarHBondContact O-N 3.09Å; N87-I90 PolarHBondContact O-N 2.93Å; K88-I90 VanDerWaalsContact C-N 3.35Å; K88-I90 PolarHBondContact O-N 2.98Å; I90-L92 PolarHBondContact O-N 2.95Å; I90-N93 PolarHBondContact O-N 3.4Å; I90-K94 PolarHBondContact O-N 3.47Å
91	K	98	Very high	97.8	Very high	153 Å²	153	111.3 Å²	111.3	67%	0.665	55%	0.549	S	S	*	.	H	α-helix	trans	-60	-45.4	177.2	-75	-177.3	178.3	-174.2	0	112	N87 K88 K94 V95	N87-K91 WeakPolarHBondContact O-CG 3.45Å; N87-K91 PolarHBondContact O-N 3.22Å; N87-K91 VanDerWaalsContact O-N 3.07Å; K88-K91 PolarHBondContact O-N 3.21Å; K91-K94 PolarHBondContact O-N 3.07Å; K91-V95 WeakPolarHBondContact O-CG2 3.35Å; K91-V95 PolarHBondContact O-N 2.97Å; K91-V95 VanDerWaalsContact O-N 3.07Å
92	L	98	Very high	97.5	Very high	99 Å²	99	112.1 Å²	112.1	52%	0.518	56%	0.56	S	S	.	*	H	α-helix	trans	-62.6	-44.1	177.7	-175.2	65.3	0	0	0	111.6	K88 K89 I90 K94 V95 N96	K88-L92 WeakPolarHBondContact O-CB 3.37Å; K88-L92 PolarHBondContact O-N 3.18Å; K89-L92 PolarHBondContact O-N 3.41Å; I90-L92 PolarHBondContact O-N 2.95Å; L92-K94 VanDerWaalsContact C-N 3.3Å; L92-K94 PolarHBondContact O-N 3.3Å; L92-V95 PolarHBondContact O-N 3.32Å; L92-N96 PolarHBondContact O-N 2.9Å
93	N	98.2	Very high	97.5	Very high	95 Å²	95	110.6 Å²	110.6	51%	0.508	56%	0.559	S	S	.	*	H	α-helix	trans	-62	-39.5	177.5	-165.8	47.4	0	0	0	111.8	K89 I90 N96 I97	K89-N93 WeakPolarHBondContact O-CB 3.47Å; K89-N93 PolarHBondContact O-N 3.47Å; I90-N93 PolarHBondContact O-N 3.4Å; N93-N96 PolarHBondContact O-N 3.33Å; N93-I97 WeakPolarHBondContact O-CG1 3.42Å; N93-I97 PolarHBondContact O-N 3.41Å
94	K	97.8	Very high	97.4	Very high	165 Å²	165	115.1 Å²	115.1	72%	0.717	58%	0.575	S	S	*	*	H	α-helix	trans	-62.1	-42.7	175.2	-171.6	176.4	-178.2	178.3	0	112.1	I90 K91 L92 H98	I90-K94 PolarHBondContact O-N 3.47Å; K91-K94 PolarHBondContact O-N 3.07Å; L92-K94 VanDerWaalsContact C-N 3.3Å; L92-K94 PolarHBondContact O-N 3.3Å; K94-H98 PolarHBondContact O-N 3.29Å; K94-H98 VanDerWaalsContact O-N 3.09Å
95	V	98	Very high	97.4	Very high	94 Å²	94	117.4 Å²	117.4	57%	0.57	58%	0.579	S	S	*	*	H	α-helix	trans	-64.1	-43.6	175.8	173.3	0	0	0	0	111.2	K91 L92 H98 L99	K91-V95 WeakPolarHBondContact O-CG2 3.35Å; K91-V95 PolarHBondContact O-N 2.97Å; K91-V95 VanDerWaalsContact O-N 3.07Å; L92-V95 PolarHBondContact O-N 3.32Å; V95-H98 PolarHBondContact O-N 3.48Å; V95-L99 PolarHBondContact O-N 3.22Å
96	N	97.6	Very high	97.4	Very high	75 Å²	75	117.6 Å²	117.6	40%	0.401	58%	0.584	S	S	.	*	H	α-helix	trans	-63	-43	178.3	-72.4	-12.1	0	0	0	112.5	L92 N93 H98 L99 I100	L92-N96 PolarHBondContact O-N 2.9Å; N93-N96 PolarHBondContact O-N 3.33Å; N96-H98 VanDerWaalsContact C-N 3.32Å; N96-H98 PolarHBondContact O-N 3.07Å; N96-L99 PolarHBondContact O-N 3.13Å; N96-I100 WeakPolarHBondContact O-CG1 3.4Å; N96-I100 PolarHBondContact O-N 3.27Å; N96-I100 VanDerWaalsContact O-N 3.13Å
97	I	97.8	Very high	97.3	Very high	84 Å²	84	120.7 Å²	120.7	43%	0.431	60%	0.598	S	S	.	*	H	α-helix	trans	-62.2	-42.7	176.1	-69.3	165.3	0	0	0	110.6	N93 L99 I100 I101	N93-I97 WeakPolarHBondContact O-CG1 3.42Å; N93-I97 PolarHBondContact O-N 3.41Å; I97-L99 VanDerWaalsContact C-N 3.31Å; I97-L99 PolarHBondContact O-N 3.3Å; I97-I100 PolarHBondContact O-N 3.09Å; I97-I101 HydrophobicContact CG2-CD1 3.71Å; I97-I101 WeakPolarHBondContact O-CG1 3.32Å; I97-I101 PolarHBondContact O-N 3.22Å
98	H	96.6	Very high	97.2	Very high	117 Å²	117	122.1 Å²	122.1	54%	0.542	60%	0.603	S	S	.	*	H	α-helix	trans	-60.7	-41.9	177.2	-175.7	55.5	0	0	0	111.9	K94 V95 N96 I100 I101 L102	K94-H98 PolarHBondContact O-N 3.29Å; K94-H98 VanDerWaalsContact O-N 3.09Å; V95-H98 PolarHBondContact O-N 3.48Å; N96-H98 VanDerWaalsContact C-N 3.32Å; N96-H98 PolarHBondContact O-N 3.07Å; H98-I100 VanDerWaalsContact C-N 3.3Å; H98-I100 PolarHBondContact O-N 3.21Å; H98-I101 PolarHBondContact O-N 3.43Å; H98-L102 WeakPolarHBondContact NE2-CD1 3.49Å; H98-L102 WeakPolarHBondContact O-CG 3.37Å; H98-L102 PolarHBondContact O-N 3Å
99	L	96.3	Very high	97.2	Very high	119 Å²	119	119.6 Å²	119.6	62%	0.623	60%	0.597	S	S	*	*	H	α-helix	trans	-65.2	-30.4	177.4	-177.5	61.4	0	0	0	113.4	V95 N96 I97	V95-L99 PolarHBondContact O-N 3.22Å; N96-L99 PolarHBondContact O-N 3.13Å; I97-L99 VanDerWaalsContact C-N 3.31Å; I97-L99 PolarHBondContact O-N 3.3Å
100	I	96.7	Very high	97.1	Very high	142 Å²	142	119.5 Å²	119.5	73%	0.728	60%	0.602	S	S	*	*	H	α-helix	trans	-76.9	-27.4	178.3	-68.2	164.2	0	0	0	112	N96 I97 H98	N96-I100 WeakPolarHBondContact O-CG1 3.4Å; N96-I100 PolarHBondContact O-N 3.27Å; N96-I100 VanDerWaalsContact O-N 3.13Å; I97-I100 PolarHBondContact O-N 3.09Å; H98-I100 VanDerWaalsContact C-N 3.3Å; H98-I100 PolarHBondContact O-N 3.21Å
101	I	96.6	Very high	97	Very high	133 Å²	133	120.3 Å²	120.3	68%	0.682	61%	0.605	S	S	*	*	H	α-helix	trans	-86.8	-19.8	-178.3	-66.7	170.1	0	0	0	112	I97 H98	I97-I101 HydrophobicContact CG2-CD1 3.71Å; I97-I101 WeakPolarHBondContact O-CG1 3.32Å; I97-I101 PolarHBondContact O-N 3.22Å; H98-I101 PolarHBondContact O-N 3.43Å
102	L	92.3	Very high	96.9	Very high	167 Å²	167	117.3 Å²	117.3	87%	0.874	60%	0.6	S	S	*	*			trans	-81.5	0	173.7	-71.5	168.9	0	0	0	111.3	H98	H98-L102 WeakPolarHBondContact NE2-CD1 3.49Å; H98-L102 WeakPolarHBondContact O-CG 3.37Å; H98-L102 PolarHBondContact O-N 3Å

Retrieved 102 of 102 residues in 169.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).